TetraVibrant LifeZillaZalalovaBINANOSpectrastoneZoo MedDinosamPETSCOSSETRechaleHalatoolPawHutZhourtaZeeDixDolityGuzzloTawatilerHemotonacdancNIZELUKKomodoDadiaeiTONAINSemfriVivaVaultKarymiMgaxyffNOBRANDiPowerECOSUBKFFKFFLucky FarmVNEKVAAqua CultureFluker'sFdksdfViflosaeF FityleTINEASURBN-LINKExotic NutritionUnbrandedMATELOONGKathsonTOMSHOOFyydesCCOCCABEL CRAFTSLuckyQwormsAMAXUNShiningloveCcdesQiiluNature ZoneAntiGuyueXZKINGTopcobeLIZEALUCKYNeptonionYcxydrOraceousSofulluedadypetBothyicrapellesReptologyBOBASNDMTebruYiliangxMCLANZOOTooyfulJJBNSHOTVIAPHomemaxsMazuriAlvinmaFOMIYESLOLIPPYYBESTYASHOunonaOuliiWEUVEBFashionChaELAYARDFENGGUIQUHONMEETDEEPCRAFFMilistenFzaqwenHibibudXpression PetNIGOONOFFIGAMMOKKHNBPTOOTPHOOWIFFYBvdfgkSERENABLEsimhoabalikhaTABLZONELuxshinyRENACLIPYCTIRCHIUPAMINGONOEtereautyPhenoficeUPOUARTSWETRACEAmosfunNUOLUXGETAJGHSDnicexmasGenericHytroveCHICHUMIDFDurnioCOMPUKASLITINKIMIHAMPPLIESWRITWAACRILSTYLEOVosareaWESIEVYAFUTUREORYYHealiftyUxcellEHJRESTOBOKUonlytechUPGRATORGAXIREKAKOWELYREOFLYUPSOPOTUTUIbaseniceAlasumYardweIFANLANDORNICERIOTITINICELazsyCATIEBYEZxpjkyuHEANUJJPTSCBSStgfyxgsYUNLIGHTSHEATSHAKINGLIFKOMEMobestechMoluckfuAURARMLETBaluueCOOPHYAMINKISSYIMIKEYAVERDANVERSEFUEENIRVAMobutofuNicehomfitYOSADIERyotijayLABSERRONAquatic FoodsEXHUMKYFONDOTINSuodokaWEAVILUXhaoqianKONTONTYGOOHOCHYlicongwlm2024POPETPOPTAILTOSSUnique BargainsYIFAEUXETHZZLEPbpboxWRISTBIQUEBPPEGKalloryleorxLULULIONM BuderNFTIGBperfeclanSUPVOXWASHWEPEYajisiBugzyBugsCIYISONFeliznaHINTRMENTMERRYHAPYonlyliuaRiouseryVisit the Amber Brook StoreVTKUHOFIChemeiy
Sort by|

Turtles in Reptiles

Uses item details. Price when purchased online

Overall pick, Tetra ReptoMin Floating Food Sticks, Soft Stick Food Formulated for Aquatic Turtles, 2.83 oz

Overall pick
Tetra ReptoMin Floating Food Sticks, Soft Stick Food Formulated for Aquatic Turtles, 2.83 oz
Available in additional 2 options
$797$2.82/ozOptions from $7.97 – $23.07
Tetra ReptoMin Floating Food Sticks, Soft Stick Food Formulated for Aquatic Turtles, 2.83 oz
4.8 out of 5 stars
4.8 out of 5 Stars. 581 reviews
Save withWalmart plus
Delivery as soon as 36 minsShipping, arrives todayPickup available

Black Lagoon Aquarium Gravel 5 Lb bag

Black Lagoon Aquarium Gravel 5 Lb bag
Available in additional 5 options
$678$1.36/lbOptions from $6.78 – $25.90
Black Lagoon Aquarium Gravel 5 Lb bag
4.6 out of 5 stars
4.6 out of 5 Stars. 280 reviews
Save withWalmart plus
Delivery as soon as 36 minsShipping, arrives todayPickup available

3-Pack Turtle Tank Filter Cartridges Replacement

3-Pack Turtle Tank Filter Cartridges Replacement
Available in additional 3 options
Now$1355$15.80Options from $13.55 – $98.99
3-Pack Turtle Tank Filter Cartridges Replacement
4.3 out of 5 stars
4.3 out of 5 Stars. 42 reviews
Save withWalmart plus
Shipping, arrives Thu, Oct 8

Best seller, Tetra ReptoMin Floating Food Sticks for Aquatic Turtles, Newts and Frogs, 8.65 oz.

Best seller
Tetra ReptoMin Floating Food Sticks for Aquatic Turtles, Newts and Frogs, 8.65 oz.
Available in additional 4 options
$1797$2.08/ozOptions from $17.97 – $71.88
Tetra ReptoMin Floating Food Sticks for Aquatic Turtles, Newts and Frogs, 8.65 oz.
4.7 out of 5 stars
4.7 out of 5 Stars. 343 reviews
Save withWalmart plus
Delivery as soon as 36 minsShipping, arrives todayPickup available

Best seller, Tetra ReptoMin 3-In-1 Select-A-Food, 1.94 Ounces (55 Grams), Food And Treats Formulated For Aquatic Turtles

Best seller
Tetra ReptoMin 3-In-1 Select-A-Food, 1.94 Ounces (55 Grams), Food And Treats Formulated For Aquatic Turtles
Sponsored
$927$4.78/oz
Tetra ReptoMin 3-In-1 Select-A-Food, 1.94 Ounces (55 Grams), Food And Treats Formulated For Aquatic Turtles
4.8 out of 5 stars
4.8 out of 5 Stars. 197 reviews
Save withWalmart plus
Delivery as soon as 36 minsShipping, arrives todayPickup available

Overall pick, Tetra ReptoMin Floating Food Sticks, Soft Stick Food Formulated for Aquatic Turtles, 2.83 oz

Overall pick
Tetra ReptoMin Floating Food Sticks, Soft Stick Food Formulated for Aquatic Turtles, 2.83 oz
Sponsored
$797$2.82/ozOptions from $7.97 – $23.07
Tetra ReptoMin Floating Food Sticks, Soft Stick Food Formulated for Aquatic Turtles, 2.83 oz
4.8 out of 5 stars
4.8 out of 5 Stars. 581 reviews
Save withWalmart plus
Delivery as soon as 36 minsShipping, arrives todayPickup available

Best seller, Tetra ReptoMin Floating Food Sticks for Aquatic Turtles, Newts and Frogs, 8.65 oz.

Best seller
Tetra ReptoMin Floating Food Sticks for Aquatic Turtles, Newts and Frogs, 8.65 oz.
Sponsored
$1797$2.08/ozOptions from $17.97 – $71.88
Tetra ReptoMin Floating Food Sticks for Aquatic Turtles, Newts and Frogs, 8.65 oz.
4.7 out of 5 stars
4.7 out of 5 Stars. 343 reviews
Save withWalmart plus
Delivery as soon as 36 minsShipping, arrives todayPickup available

ZeeDix 50QT Sphagnum Moss for Reptile (Leopards, Geckos, Snakes, Turtles, Frogs), Reptile Moss Bedding for Terrarium Plants, Long Fiber Reptile Moss (2.2LBS Green Natural Sphagnum Moss)

ZeeDix 50QT Sphagnum Moss for Reptile (Leopards, Geckos, Snakes, Turtles, Frogs), Reptile Moss Bedding for Terrarium Plants, Long Fiber Reptile Moss (2.2LBS Green Natural Sphagnum Moss)
Sponsored
Now$2099$26.99Options from $9.99
ZeeDix 50QT Sphagnum Moss for Reptile (Leopards, Geckos, Snakes, Turtles, Frogs), Reptile Moss Bedding for Terrarium Plants, Long Fiber Reptile Moss (2.2LBS Green Natural Sphagnum Moss)
4.2 out of 5 stars
4.2 out of 5 Stars. 92 reviews
Save withWalmart plus
Shipping, arrives tomorrow

Best seller, Spectrastone Permaglo Rainbow Aquarium Gravel 2 lb Bag

Best seller
Spectrastone Permaglo Rainbow Aquarium Gravel 2 lb Bag
Available in additional 3 options
$378$1.89/lb
Spectrastone Permaglo Rainbow Aquarium Gravel 2 lb Bag
4.8 out of 5 stars
4.8 out of 5 Stars. 92 reviews
Save withWalmart plus
Delivery as soon as 36 minsShipping, arrives todayPickup available

Deal , 12x6x7 Turtle Starter Kit High-Definition Aquatic Turtle Tank with Heating Lamp, Filter, Advanced Ventilation & High-Temp Resistance for Turtle Terrarium Habitat

12x6x7 Turtle Starter Kit High-Definition Aquatic Turtle Tank with Heating Lamp, Filter, Advanced Ventilation & High-Temp Resistance for Turtle Terrarium Habitat
Available in additional 3 options
Now$4333$48.99Options from $43.33 – $80.00
Deal
12x6x7 Turtle Starter Kit High-Definition Aquatic Turtle Tank with Heating Lamp, Filter, Advanced Ventilation & High-Temp Resistance for Turtle Terrarium Habitat
3.9 out of 5 stars
3.9 out of 5 Stars. 60 reviews
Save withWalmart plus
Free shipping, arrives Thu, Oct 8

ZALALOVA Dual Reptile Heat Lamp Fixture with Independent Switches,Reptile Light Dome Max 160 Watt,Bearded Dragon Heating Lamp Terrarium UVB Light for Turtle Tank Vivarium Hermit Crab,2 Bulbs 75W

ZALALOVA Dual Reptile Heat Lamp Fixture with Independent Switches,Reptile Light Dome Max 160 Watt,Bearded Dragon Heating Lamp Terrarium UVB Light for Turtle Tank Vivarium Hermit Crab,2 Bulbs 75W
Sponsored
Now$3299$45.99
ZALALOVA Dual Reptile Heat Lamp Fixture with Independent Switches,Reptile Light Dome Max 160 Watt,Bearded Dragon Heating Lamp Terrarium UVB Light for Turtle Tank Vivarium Hermit Crab,2 Bulbs 75W
3.3 out of 5 stars
3.3 out of 5 Stars. 3 reviews
Save withWalmart plus
Shipping, arrives tomorrow

PETSCOSSET Tortoise Habitat Turtle Enclosure with Detachable Legs, Wooden Indoor Reptile Cage for Small Animals with Leakproof Tray

PETSCOSSET Tortoise Habitat Turtle Enclosure with Detachable Legs, Wooden Indoor Reptile Cage for Small Animals with Leakproof Tray
Sponsored
Now$10999$152.99
PETSCOSSET Tortoise Habitat Turtle Enclosure with Detachable Legs, Wooden Indoor Reptile Cage for Small Animals with Leakproof Tray
4.3 out of 5 stars
4.3 out of 5 Stars. 72 reviews
Save withWalmart plus
Free shipping, arrives tomorrow

Best seller, Vibrant Life 75W Terrarium Heat Bulb, Red

Best seller
Vibrant Life 75W Terrarium Heat Bulb, Red
Available in additional 4 options
$852Options from $8.52 – $32.38
Vibrant Life 75W Terrarium Heat Bulb, Red
4.6 out of 5 stars
4.6 out of 5 Stars. 115 reviews
Save withWalmart plus
Delivery as soon as 36 minsShipping, arrives todayPickup available

Best seller, Tetra ReptoMin 3-In-1 Select-A-Food, 1.94 Ounces (55 Grams), Food And Treats Formulated For Aquatic Turtles

Best seller
Tetra ReptoMin 3-In-1 Select-A-Food, 1.94 Ounces (55 Grams), Food And Treats Formulated For Aquatic Turtles
$927$4.78/oz
Tetra ReptoMin 3-In-1 Select-A-Food, 1.94 Ounces (55 Grams), Food And Treats Formulated For Aquatic Turtles
4.8 out of 5 stars
4.8 out of 5 Stars. 197 reviews
Save withWalmart plus
Delivery as soon as 36 minsShipping, arrives todayPickup available

ZeeDix 8OZ Premium Sphagnum Moss for Reptile, 12QT Green Natural Live Moss Reptile Moss Bedding for Terrarium Plants, Long Fiber Reptile Moss for Leopards, Geckos, Snakes, Turtles, Frogs

ZeeDix 8OZ Premium Sphagnum Moss for Reptile, 12QT Green Natural Live Moss Reptile Moss Bedding for Terrarium Plants, Long Fiber Reptile Moss for Leopards, Geckos, Snakes, Turtles, Frogs
1.1LB, variant on ZeeDix 8OZ Premium Sphagnum Moss for Reptile, 12QT Green Natural Live Moss Reptile Moss Bedding for Terrarium Plants, Long Fiber Reptile Moss for Leopards, Geckos, Snakes, Turtles, Frogs
2.2LB, variant on ZeeDix 8OZ Premium Sphagnum Moss for Reptile, 12QT Green Natural Live Moss Reptile Moss Bedding for Terrarium Plants, Long Fiber Reptile Moss for Leopards, Geckos, Snakes, Turtles, Frogs
8oz, variant on ZeeDix 8OZ Premium Sphagnum Moss for Reptile, 12QT Green Natural Live Moss Reptile Moss Bedding for Terrarium Plants, Long Fiber Reptile Moss for Leopards, Geckos, Snakes, Turtles, Frogs
12oz, variant on ZeeDix 8OZ Premium Sphagnum Moss for Reptile, 12QT Green Natural Live Moss Reptile Moss Bedding for Terrarium Plants, Long Fiber Reptile Moss for Leopards, Geckos, Snakes, Turtles, Frogs
$999Options from $9.99 – $20.99
ZeeDix 8OZ Premium Sphagnum Moss for Reptile, 12QT Green Natural Live Moss Reptile Moss Bedding for Terrarium Plants, Long Fiber Reptile Moss for Leopards, Geckos, Snakes, Turtles, Frogs
4.2 out of 5 stars
4.2 out of 5 Stars. 92 reviews
Save withWalmart plus
Shipping, arrives tomorrow

ZALALOVA Dual Reptile Heat Lamp Fixture with Independent Switches,Reptile Light Dome Max 160 Watt,Bearded Dragon Heating Lamp Terrarium UVB Light for Turtle Tank Vivarium Hermit Crab,2 Bulbs 75W

ZALALOVA Dual Reptile Heat Lamp Fixture with Independent Switches,Reptile Light Dome Max 160 Watt,Bearded Dragon Heating Lamp Terrarium UVB Light for Turtle Tank Vivarium Hermit Crab,2 Bulbs 75W
Now$3299$45.99
ZALALOVA Dual Reptile Heat Lamp Fixture with Independent Switches,Reptile Light Dome Max 160 Watt,Bearded Dragon Heating Lamp Terrarium UVB Light for Turtle Tank Vivarium Hermit Crab,2 Bulbs 75W
3.3 out of 5 stars
3.3 out of 5 Stars. 3 reviews
Save withWalmart plus
Shipping, arrives tomorrow

Vibrant Life Floating Turtle Platform Terrarium Decor

Vibrant Life Floating Turtle Platform Terrarium Decor
$1997
Vibrant Life Floating Turtle Platform Terrarium Decor
4.6 out of 5 stars
4.6 out of 5 Stars. 63 reviews
Save withWalmart plus
Delivery as soon as 36 minsShipping, arrives todayPickup available

Zoo Med Dr. Turtle Slow Release Calcium Block, 0.5-Ounce

Zoo Med Dr. Turtle Slow Release Calcium Block, 0.5-Ounce
$648
Zoo Med Dr. Turtle Slow Release Calcium Block, 0.5-Ounce
4.3 out of 5 stars
4.3 out of 5 Stars. 18 reviews
Save withWalmart plus
Shipping, arrives tomorrow

Austok Turtle Basking Platform, Simulation Grass Turtle Ramp for Turtle Tank, Tank Accessories Reptile Climbing Ladder Ramp Resting Terrace,for Reptile Frog Terrapin

Austok Turtle Basking Platform, Simulation Grass Turtle Ramp for Turtle Tank, Tank Accessories Reptile Climbing Ladder Ramp Resting Terrace,for Reptile Frog Terrapin
Available in additional 3 sizes
$859+$3.99 shippingOptions from $5.79
Austok Turtle Basking Platform, Simulation Grass Turtle Ramp for Turtle Tank, Tank Accessories Reptile Climbing Ladder Ramp Resting Terrace,for Reptile Frog Terrapin
4.5 out of 5 stars
4.5 out of 5 Stars. 12 reviews
Shipping, arrives in 3+ days

Best seller, Vibrant Life Aquatic Turtle Diet Trail Mix, 3 oz

Best seller
Vibrant Life Aquatic Turtle Diet Trail Mix, 3 oz
Available in additional 5 options
$512$1.71/ozOptions from $5.12 – $58.37
Vibrant Life Aquatic Turtle Diet Trail Mix, 3 oz
4.7 out of 5 stars
4.7 out of 5 Stars. 316 reviews
Save withWalmart plus
Delivery as soon as 36 minsShipping, arrives todayPickup available

Reptile Heat Lamp(2 Packs)-Ceramic Heat Emitter For Reptiles Amphibian Pet Brooders Chicken Incubation, and Terrariums Turtle Lizard Bearded Dragon Snake E26

Reptile Heat Lamp(2 Packs)-Ceramic Heat Emitter For Reptiles Amphibian Pet Brooders Chicken Incubation, and Terrariums Turtle Lizard Bearded Dragon Snake E26
Sponsored
$999
Reptile Heat Lamp(2 Packs)-Ceramic Heat Emitter For Reptiles Amphibian Pet Brooders Chicken Incubation, and Terrariums Turtle Lizard Bearded Dragon Snake E26
4.2 out of 5 stars
4.2 out of 5 Stars. 6 reviews
Free shipping, arrives in 3+ days

Deal, T5 UVB Reptile Light Fixture Combo Kit, 24W UVA UVB Fluorescent Tube, 10.0 UVB for Bearded Dragons, Tortoises, and Desert Reptiles, 22-inch Hood

T5 UVB Reptile Light Fixture Combo Kit, 24W UVA UVB Fluorescent Tube, 10.0 UVB for Bearded Dragons, Tortoises, and Desert Reptiles, 22-inch Hood
Sponsored
$3728Options from $23.90
Deal
T5 UVB Reptile Light Fixture Combo Kit, 24W UVA UVB Fluorescent Tube, 10.0 UVB for Bearded Dragons, Tortoises, and Desert Reptiles, 22-inch Hood
4.5 out of 5 stars
4.5 out of 5 Stars. 138 reviews
Save withWalmart plus
Free shipping, arrives tomorrow

Reduced price, Deluxe Aquatic , Aquarium Box for Turtle Reptile Habitat Tank with Basking Ramp Platform Plants White

Deluxe Aquatic , Aquarium Box for Turtle Reptile Habitat Tank with Basking Ramp Platform Plants White
Now$1899$25.99
Reduced price
Deluxe Aquatic , Aquarium Box for Turtle Reptile Habitat Tank with Basking Ramp Platform Plants White
3.9 out of 5 stars
3.9 out of 5 Stars. 14 reviews
Free shipping, arrives in 3+ days

Vibrant Life Aquatic Turtle Treat, Insect Mix, 1.35 oz

Vibrant Life Aquatic Turtle Treat, Insect Mix, 1.35 oz
Available in additional 3 options
$826$6.12/ozOptions from $8.26 – $31.39
Vibrant Life Aquatic Turtle Treat, Insect Mix, 1.35 oz
4.8 out of 5 stars
4.8 out of 5 Stars. 95 reviews
Save withWalmart plus
Delivery as soon as 36 minsShipping, arrives todayPickup available

Turtle Resting Basking Platform Grass Turtle Ramp, Tortoise Resting Terraces Grass Animal Reptile Pier Green

Turtle Resting Basking Platform Grass Turtle Ramp, Tortoise Resting Terraces Grass Animal Reptile Pier Green
Available in additional 2 sizes
$940Options from $7.35
Turtle Resting Basking Platform Grass Turtle Ramp, Tortoise Resting Terraces Grass Animal Reptile Pier Green
4.3 out of 5 stars
4.3 out of 5 Stars. 7 reviews
Free shipping, arrives in 3+ days

Turtle Tank Kit with Basking LED Heat Lamp, Aquatic and Terrestrial Habitat for Small Reptiles, Includes Basking Platform and Decorations, Complete Setup for Pet Turtles

Turtle Tank Kit with Basking LED Heat Lamp, Aquatic and Terrestrial Habitat for Small Reptiles, Includes Basking Platform and Decorations, Complete Setup for Pet Turtles
$4498
Turtle Tank Kit with Basking LED Heat Lamp, Aquatic and Terrestrial Habitat for Small Reptiles, Includes Basking Platform and Decorations, Complete Setup for Pet Turtles
3.7 out of 5 stars
3.7 out of 5 Stars. 11 reviews
Free shipping, arrives in 3+ days

Reptile Heat Lamp, Reptile Light for Turtle Lamp with Clamp, UVA UVB Light for Reptiles with with Adjustable Switch,360 Rotatable Turtle Accessories for Aquarium

Reptile Heat Lamp, Reptile Light for Turtle Lamp with Clamp, UVA UVB Light for Reptiles with with Adjustable Switch,360 Rotatable Turtle Accessories for Aquarium
Now$1699$26.99
Reptile Heat Lamp, Reptile Light for Turtle Lamp with Clamp, UVA UVB Light for Reptiles with with Adjustable Switch,360 Rotatable Turtle Accessories for Aquarium
4.3 out of 5 stars
4.3 out of 5 Stars. 151 reviews
Save withWalmart plus
Shipping, arrives tomorrow

PawHut Triple-Filtering Turtle Tank Reptile Enclosure Turtle Habitat

PawHut Triple-Filtering Turtle Tank Reptile Enclosure Turtle Habitat
$4749
PawHut Triple-Filtering Turtle Tank Reptile Enclosure Turtle Habitat
3.9 out of 5 stars
3.9 out of 5 Stars. 40 reviews
Free shipping, arrives Thu, Oct 8

Rechale Turtle Tank, Turtle Aquarium with Basking Platform and Bottom Drainage,Basking Lamp & 9-in-1 Starter Kit (Decorative Plants Included) for Turtles, Crayfish, Crabs, Amphibians, Reptiles

Rechale Turtle Tank, Turtle Aquarium with Basking Platform and Bottom Drainage,Basking Lamp & 9-in-1 Starter Kit (Decorative Plants Included) for Turtles, Crayfish, Crabs, Amphibians, Reptiles
$5999
Rechale Turtle Tank, Turtle Aquarium with Basking Platform and Bottom Drainage,Basking Lamp & 9-in-1 Starter Kit (Decorative Plants Included) for Turtles, Crayfish, Crabs, Amphibians, Reptiles
4 out of 5 stars
4 out of 5 Stars. 68 reviews
Save withWalmart plus
Free shipping, arrives tomorrow

AMAXUN Large Turtle Pier & Basking Platform for 20+ Gallon Tanks, Adjustable Height

AMAXUN Large Turtle Pier & Basking Platform for 20+ Gallon Tanks, Adjustable Height
Available in additional 2 sizes
Now$2299$25.99Options from $15.99
AMAXUN Large Turtle Pier & Basking Platform for 20+ Gallon Tanks, Adjustable Height
4.1 out of 5 stars
4.1 out of 5 Stars. 21 reviews
Save withWalmart plus
Shipping, arrives Wed, Oct 7

Deal , 12x6x7 Turtle Starter Kit High-Definition Aquatic Turtle Tank with Heating Lamp, Filter, Advanced Ventilation & High-Temp Resistance for Turtle Terrarium Habitat

12x6x7 Turtle Starter Kit High-Definition Aquatic Turtle Tank with Heating Lamp, Filter, Advanced Ventilation & High-Temp Resistance for Turtle Terrarium Habitat
Sponsored
Now$4333$48.99Options from $43.33 – $80.00
Deal
12x6x7 Turtle Starter Kit High-Definition Aquatic Turtle Tank with Heating Lamp, Filter, Advanced Ventilation & High-Temp Resistance for Turtle Terrarium Habitat
3.9 out of 5 stars
3.9 out of 5 Stars. 60 reviews
Save withWalmart plus
Free shipping, arrives Thu, Oct 8

Deal, 100W Reptile Heat Lamp Bulb, Daylight Basking Spot Lamp with UVA, Standard Pet Heating Light for Tortoise, Bearded Dragon, Lizard and Amphibians

100W Reptile Heat Lamp Bulb, Daylight Basking Spot Lamp with UVA, Standard Pet Heating Light for Tortoise, Bearded Dragon, Lizard and Amphibians
Sponsored
Now$1119$13.99Options from $11.19 – $12.79
Deal
100W Reptile Heat Lamp Bulb, Daylight Basking Spot Lamp with UVA, Standard Pet Heating Light for Tortoise, Bearded Dragon, Lizard and Amphibians
5 out of 5 stars
5 out of 5 Stars. 2 reviews
Save withWalmart plus
Shipping, arrives tomorrow

Zilla Omnivore Reptile Medley Complete Diet, 4 Ounces (1 Pack)

Zilla Omnivore Reptile Medley Complete Diet, 4 Ounces (1 Pack)
Available in additional 4 options
$797$1.99/ozOptions from $7.97 – $30.45
Zilla Omnivore Reptile Medley Complete Diet, 4 Ounces (1 Pack)
4.3 out of 5 stars
4.3 out of 5 Stars. 204 reviews
Save withWalmart plus
Delivery as soon as 30 minsShipping, arrives todayPickup available

Walfront Floating Basking Platform for Reptile Turtles Frogs Ramp Pier

Walfront Floating Basking Platform for Reptile Turtles Frogs Ramp Pier
$1411
Walfront Floating Basking Platform for Reptile Turtles Frogs Ramp Pier
3.4 out of 5 stars
3.4 out of 5 Stars. 14 reviews
Save withWalmart plus
Shipping, arrives Thu, Oct 8

Deal , Gecko Tank & Reptile Terrarium Kit with Heat Lamp, Spray Bottle, Tools & Hideout - Perfect Habitat for Lizards, Snakes, Turtles, Hermit Crabs, Frogs, Jumping Spiders 12.5x6x7 Inch

Gecko Tank & Reptile Terrarium Kit with Heat Lamp, Spray Bottle, Tools & Hideout - Perfect Habitat for Lizards, Snakes, Turtles, Hermit Crabs, Frogs, Jumping Spiders 12.5x6x7 Inch
Available in additional 4 options
Now$4139$45.99Options from $35.99
Deal
Gecko Tank & Reptile Terrarium Kit with Heat Lamp, Spray Bottle, Tools & Hideout - Perfect Habitat for Lizards, Snakes, Turtles, Hermit Crabs, Frogs, Jumping Spiders 12.5x6x7 Inch
4.1 out of 5 stars
4.1 out of 5 Stars. 63 reviews
Save withWalmart plus
Free shipping, arrives Thu, Oct 8

Zoo Med Floating Turtle Dock - Small - 10 Gallon Tanks (11.25" Long x 5" Wide)

Zoo Med Floating Turtle Dock - Small - 10 Gallon Tanks (11.25" Long x 5" Wide)
Available in additional 3 options
$1793Options from $17.93 – $36.98
Zoo Med Floating Turtle Dock - Small - 10 Gallon Tanks (11.25" Long x 5" Wide)
4.1 out of 5 stars
4.1 out of 5 Stars. 41 reviews
Save withWalmart plus
Shipping, arrives tomorrow

Zilla Terrarium Heat Mat for Reptiles, Black, Small, 10-20 Gallon, 8 Watt

Zilla Terrarium Heat Mat for Reptiles, Black, Small, 10-20 Gallon, 8 Watt
Available in additional 4 options
Now$2097$24.00Options from $20.97 – $80.11
Zilla Terrarium Heat Mat for Reptiles, Black, Small, 10-20 Gallon, 8 Watt
4.3 out of 5 stars
4.3 out of 5 Stars. 113 reviews
Save withWalmart plus
Delivery as soon as 30 minsShipping, arrives todayPickup available

Reptile Heat Lamp(2 Packs)-Ceramic Heat Emitter For Reptiles Amphibian Pet Brooders Chicken Incubation, and Terrariums Turtle Lizard Bearded Dragon Snake E26

Reptile Heat Lamp(2 Packs)-Ceramic Heat Emitter For Reptiles Amphibian Pet Brooders Chicken Incubation, and Terrariums Turtle Lizard Bearded Dragon Snake E26
$999
Reptile Heat Lamp(2 Packs)-Ceramic Heat Emitter For Reptiles Amphibian Pet Brooders Chicken Incubation, and Terrariums Turtle Lizard Bearded Dragon Snake E26
4.2 out of 5 stars
4.2 out of 5 Stars. 6 reviews
Free shipping, arrives in 3+ days

Zoo Med Aquatic Turtle Banquet Block Food and Calcium Supplement Regular 5 pack

Zoo Med Aquatic Turtle Banquet Block Food and Calcium Supplement Regular 5 pack
$840
Zoo Med Aquatic Turtle Banquet Block Food and Calcium Supplement Regular 5 pack
4.6 out of 5 stars
4.6 out of 5 Stars. 25 reviews
Save withWalmart plus
Shipping, arrives tomorrow

Tawatiler 8-Inch LED UVA UVB Light for Reptiles, Full Spectrum UVA & UVB Reptile Light with Auto 24-Hour Cycle Timer & 10 Dimmable with Controller for Turtles, Snakes, and Bearded Dragons

Tawatiler 8-Inch LED UVA UVB Light for Reptiles, Full Spectrum UVA & UVB Reptile Light with Auto 24-Hour Cycle Timer & 10 Dimmable with Controller for Turtles, Snakes, and Bearded Dragons
Available in additional 3 options
$2849Options from $28.49 – $45.59
Tawatiler 8-Inch LED UVA UVB Light for Reptiles, Full Spectrum UVA & UVB Reptile Light with Auto 24-Hour Cycle Timer & 10 Dimmable with Controller for Turtles, Snakes, and Bearded Dragons
4.1 out of 5 stars
4.1 out of 5 Stars. 24 reviews
Save withWalmart plus
Shipping, arrives Wed, Oct 7

Deal, ZALALOVA Acrylic Jumping Spider Enclosure - Insect Terrarium for Spiders, Reptiles Habitat for Praying Mantis, Tarantula, Snail, Hermit Crab, Frog

ZALALOVA Acrylic Jumping Spider Enclosure - Insect Terrarium for Spiders, Reptiles Habitat for Praying Mantis, Tarantula, Snail, Hermit Crab, Frog
Available in additional 2 options
Now$1199$19.99Options from $11.99 – $14.39
Deal
ZALALOVA Acrylic Jumping Spider Enclosure - Insect Terrarium for Spiders, Reptiles Habitat for Praying Mantis, Tarantula, Snail, Hermit Crab, Frog
4.5 out of 5 stars
4.5 out of 5 Stars. 69 reviews
Save withWalmart plus
Shipping, arrives tomorrow

2PCS Reptile Wood Branches Decor Lizard Habitat Decoration Snake Climbing Branch Accessories Terrarium Tree Trunk Ornament for Bearded Dragon Gecko Frog Chameleon Spider

2PCS Reptile Wood Branches Decor Lizard Habitat Decoration Snake Climbing Branch Accessories Terrarium Tree Trunk Ornament for Bearded Dragon Gecko Frog Chameleon Spider
Type-1, variant on 2PCS Reptile Wood Branches Decor Lizard Habitat Decoration Snake Climbing Branch Accessories Terrarium Tree Trunk Ornament for Bearded Dragon Gecko Frog Chameleon Spider
Type-2, variant on 2PCS Reptile Wood Branches Decor Lizard Habitat Decoration Snake Climbing Branch Accessories Terrarium Tree Trunk Ornament for Bearded Dragon Gecko Frog Chameleon Spider
Type-3, variant on 2PCS Reptile Wood Branches Decor Lizard Habitat Decoration Snake Climbing Branch Accessories Terrarium Tree Trunk Ornament for Bearded Dragon Gecko Frog Chameleon Spider
Type-4, variant on 2PCS Reptile Wood Branches Decor Lizard Habitat Decoration Snake Climbing Branch Accessories Terrarium Tree Trunk Ornament for Bearded Dragon Gecko Frog Chameleon Spider
$1899Options from $17.66
2PCS Reptile Wood Branches Decor Lizard Habitat Decoration Snake Climbing Branch Accessories Terrarium Tree Trunk Ornament for Bearded Dragon Gecko Frog Chameleon Spider
3.7 out of 5 stars
3.7 out of 5 Stars. 22 reviews
Save withWalmart plus
Shipping, arrives tomorrow

PETSCOSSET Tortoise Habitat Turtle Enclosure with Detachable Legs, Wooden Indoor Reptile Cage for Small Animals with Leakproof Tray

PETSCOSSET Tortoise Habitat Turtle Enclosure with Detachable Legs, Wooden Indoor Reptile Cage for Small Animals with Leakproof Tray
Now$10999$152.99
PETSCOSSET Tortoise Habitat Turtle Enclosure with Detachable Legs, Wooden Indoor Reptile Cage for Small Animals with Leakproof Tray
4.3 out of 5 stars
4.3 out of 5 Stars. 72 reviews
Save withWalmart plus
Free shipping, arrives tomorrow

Deal, 100W Reptile Heat Lamp Bulb, Daylight Basking Spot Lamp with UVA, Standard Pet Heating Light for Tortoise, Bearded Dragon, Lizard and Amphibians

100W Reptile Heat Lamp Bulb, Daylight Basking Spot Lamp with UVA, Standard Pet Heating Light for Tortoise, Bearded Dragon, Lizard and Amphibians
Available in additional 2 options
Now$1119$13.99Options from $11.19 – $12.79
Deal
100W Reptile Heat Lamp Bulb, Daylight Basking Spot Lamp with UVA, Standard Pet Heating Light for Tortoise, Bearded Dragon, Lizard and Amphibians
5 out of 5 stars
5 out of 5 Stars. 2 reviews
Save withWalmart plus
Shipping, arrives tomorrow

Turtle Tank Kit with 3-Stage Filtration, Basking Platform & Heat Lamp - Turtle Aquarium Habitat for Water Turtles, Easy Drain Turtle Starter Kit, Turtle Enclosure, Tortoise Tank & Hermit Crab Tank

Turtle Tank Kit with 3-Stage Filtration, Basking Platform & Heat Lamp - Turtle Aquarium Habitat for Water Turtles, Easy Drain Turtle Starter Kit, Turtle Enclosure, Tortoise Tank & Hermit Crab Tank
Available in additional 2 options
$5999Options from $59.99 – $99.99
Turtle Tank Kit with 3-Stage Filtration, Basking Platform & Heat Lamp - Turtle Aquarium Habitat for Water Turtles, Easy Drain Turtle Starter Kit, Turtle Enclosure, Tortoise Tank & Hermit Crab Tank
5 out of 5 stars
5 out of 5 Stars. 2 reviews
Save withWalmart plus
Free shipping, arrives Thu, Oct 8

ZULAR Reptile Hideout,Tortoise Hide Cave,Resin Rock,Bearded Dragon Hideaway,Turtle Basking Platform,Reptiles Habitat Decor Tank Accessories for Lizards Gecko Snakes Chameleon Frogs

ZULAR Reptile Hideout,Tortoise Hide Cave,Resin Rock,Bearded Dragon Hideaway,Turtle Basking Platform,Reptiles Habitat Decor Tank Accessories for Lizards Gecko Snakes Chameleon Frogs
$2004
ZULAR Reptile Hideout,Tortoise Hide Cave,Resin Rock,Bearded Dragon Hideaway,Turtle Basking Platform,Reptiles Habitat Decor Tank Accessories for Lizards Gecko Snakes Chameleon Frogs
Free shipping, arrives in 3+ days

ZALALOVA Reptile Lamp Stand,Reptile Light Stand with Flexible Bracket,Adjustable Height 15.7" to 74.3" with 360 Swing Arm,Heat Lamp Holder for Bearded Dragon,Turtle,Snake Lizard Terrariums

ZALALOVA Reptile Lamp Stand,Reptile Light Stand with Flexible Bracket,Adjustable Height 15.7" to 74.3" with 360 Swing Arm,Heat Lamp Holder for Bearded Dragon,Turtle,Snake Lizard Terrariums
Now$2960$49.99
ZALALOVA Reptile Lamp Stand,Reptile Light Stand with Flexible Bracket,Adjustable Height 15.7" to 74.3" with 360 Swing Arm,Heat Lamp Holder for Bearded Dragon,Turtle,Snake Lizard Terrariums
5 out of 5 stars
5 out of 5 Stars. 1 reviews
Save withWalmart plus
Shipping, arrives tomorrow

Zoo Med Turtle Bone 1 Pack

Zoo Med Turtle Bone 1 Pack
$843
Zoo Med Turtle Bone 1 Pack
4.2 out of 5 stars
4.2 out of 5 Stars. 14 reviews
Save withWalmart plus
Shipping, arrives tomorrow

Deal, Halatool 2 Pack Snake Bedding Natural Coconut Chips Substrate 2.2 LB Coconut Husk for Reptiles Tank Terrarium Substrate for Ball Python Frog Gecko

Halatool 2 Pack Snake Bedding Natural Coconut Chips Substrate 2.2 LB Coconut Husk for Reptiles Tank Terrarium Substrate for Ball Python Frog Gecko
Available in additional 3 sizes
Now$1078$11.98Options from $10.78 – $20.51
Deal
Halatool 2 Pack Snake Bedding Natural Coconut Chips Substrate 2.2 LB Coconut Husk for Reptiles Tank Terrarium Substrate for Ball Python Frog Gecko
4.9 out of 5 stars
4.9 out of 5 Stars. 18 reviews
Save withWalmart plus
Shipping, arrives Wed, Oct 7

Zoo Med Box Turtle & Tortoise Reptile Food, 10 Oz

Zoo Med Box Turtle & Tortoise Reptile Food, 10 Oz
$1007$1.01/oz
Zoo Med Box Turtle & Tortoise Reptile Food, 10 Oz
4.3 out of 5 stars
4.3 out of 5 Stars. 20 reviews
Save withWalmart plus
Shipping, arrives tomorrow

About Turtles in Reptiles - Walmart.com

Turtle supplies help you build a cleaner, more organized habitat for aquatic turtles, box turtles, and tortoises. You can compare food, filters, basking platforms, heating lamps, and tanks in one place.

When you set up a turtle habitat, you need dry basking space and roomy swimming space. You also need dependable filtration, steady lighting, and food that matches your turtle’s routine.

How to choose turtle supplies for your setup

You should start with product type, turtle type, and tank capacity before you compare smaller details. Those choices shape how much water you manage, how much land space you need, and how often you clean.

If you keep aquatic turtles, you’ll usually need tanks, turtle filters, a turtle basking platform, and a turtle heat lamp. If you keep box turtles or tortoises, you’ll focus more on land space, heating, and feeding tools.

You can use this quick checklist to compare your core habitat needs. You’ll make faster choices when you match each item to your enclosure size and species.

  • You should check gallon rating before you choose tanks and filters.
  • You should compare basking space size with your turtle’s shell length.
  • You should match heating and UV output to your enclosure layout.
  • You should choose turtle food by life stage and feeding routine.
  • You should add turtle water conditioner when your setup includes tap water.

Choosing turtle tank accessories by tank capacity

You should measure your enclosure first because tank capacity changes every other decision. A 20 gallon setup needs different flow, dock size, and lamp reach than a 75 gallon habitat.

When you compare turtle tank accessories, look for gallon ratings and check whether they match your water volume. You’ll usually want turtle filters with enough GPH flow rate to move water efficiently.

If you use a larger 100+ gallon enclosure, you should compare equipment built for higher output. You’ll notice stronger filtration matters when turtles create more waste than many fish setups.

You should also compare docks, ramps, and platforms by footprint and stability. A turtle dock that sits securely above the water helps you create a clear resting and basking zone.

Choosing filters, heating, and a turtle basking platform

You should think about filtration and basking as a connected system, not separate purchases. Clear water and a dry platform help you maintain a habitat with distinct swimming and resting areas.

When you compare turtle filters, check gallon rating and GPH flow rate together. Higher flow can support larger tanks, while the right rating helps you avoid undersized equipment.

You should look for a turtle basking platform that gives your pet enough dry surface to climb and rest. The right platform helps you keep the shell fully out of the water.

For heating, you should compare bulb wattage and fixture fit with your enclosure height. You’ll want a turtle heat lamp setup that reaches the basking area without crowding your tank lid.

You should also review UVA and UVB guidance when you compare lamps for daily habitat use. Those specs help you understand coverage, bulb type, and placement for your enclosure layout.

If your setup uses tap water, you should add turtle water conditioner to your routine. You’ll make water changes easier when you prepare water before it enters the tank.

Choosing turtle food by diet and feeding routine

You should choose turtle food by species, age, and nutrition form instead of picking one formula for every reptile. Pellets, sticks, freeze-dried shrimp, and gel food each fit different feeding habits.

For everyday feeding, you may prefer pellets or sticks because you can portion them consistently. You’ll often use freeze-dried shrimp as an occasional addition rather than a daily base.

Gel food can work well when you want a softer format with easy portion control. You should compare texture and feeding instructions to keep your routine simple.

If you care for aquatic turtles, you may need food that works cleanly in and around water. You’ll also want feeding tools and storage that help you keep the habitat tidier between cleanings.

Matching turtle supplies to common habitat setups

You should match your equipment to the type of turtle you keep and the space you maintain. An aquatic turtle setup usually needs a tank, a dock, stronger filtration, conditioned water, and overhead heating.

For a 40 gallon aquatic habitat, you might pair a mid-size dock with a filter rated for that volume. You can then add a heat lamp and food format that fits your daily schedule.

For a 75 gallon or larger enclosure, you should compare higher-capacity turtle filters and larger basking areas. You’ll usually need wider coverage from lighting when the enclosure footprint grows.

If you keep a box turtle or tortoise, you should focus on land-based layout and feeding access. You can compare heating lamps, food dishes, and habitat tools that support a drier environment.

You should also think about maintenance when you build your list of turtle supplies. The right mix of conditioner, filtration, feeding formats, and habitat accessories helps you keep care tasks more manageable.

With the right turtle supplies, you can create a habitat that supports clean water, dependable basking space, and simple feeding routines. You’ll feel more confident when each part of your setup matches your turtle and tank size.

FAQ

What are some cool facts about turtles?

  • Turtles are reptiles: They breathe air and have scaly skin.
  • Shells are unique: Each turtle's shell is made of bone and grows with them.
  • Long lifespans: Many turtles can live for decades, sometimes over 50 years.
  • Variety of habitats: Some turtles live in water, others on land.
  • Omnivorous diets: Most turtles eat both plants and animals, depending on their species and age.

Turtles are fascinating pets, and learning about their traits can help you care for them better!

What snacks do turtles like best?

Turtles enjoy a variety of snacks, but their favorites often include:

  • Insects like mealworms or crickets
  • Leafy greens such as romaine lettuce
  • Small bits of fruit (like strawberries or melon)
  • Specially formulated turtle treats

Always check that snacks are safe for your turtle's species and offer treats in moderation alongside their regular diet.

How can I make my turtle happy?

  • Provide a spacious habitat: Turtles need room to swim and explore.
  • Offer basking spots: A warm, dry area lets them rest and absorb heat.
  • Keep water clean: Regularly change and filter tank water for their health.
  • Give varied food: Mix up their diet with pellets, veggies, and treats.
  • Add enrichment: Decorate with ramps, platforms, and plants to keep them active.

These steps can help create a comfortable and stimulating environment for your turtle.

What do turtles need in their tank?

  • Clean water: Use a filter to keep water fresh.
  • Basking area: Include a platform or ramp for drying off and warming up.
  • Heat and UVB lamp: Proper lighting supports their health and shell growth.
  • Safe substrate: Gravel or moss can line the tank floor.
  • Decor: Plants and hiding spots make the habitat more natural.

Setting up these essentials helps your turtle thrive in their new home.

How do I clean a turtle tank safely?

  1. Remove your turtle and place it somewhere safe.
  2. Drain the tank water and take out decorations.
  3. Scrub the tank walls with a reptile-safe cleaner or warm water.
  4. Rinse everything thoroughly to remove residue.
  5. Replace clean water, reinstall decorations, and return your turtle.

Regular cleaning helps prevent odors and keeps your turtle healthy. Always use products designed for reptiles and avoid harsh chemicals.