Hostage TapeDoctor EasyEquateParroxHyland'sUnbrandedHoward ProductsKabuerHvxrjknApmemissSTONCELHaxmnouMedlineOPTI-FREEFleetXecaoUxcellYAZXHJAZOcibmnUnique BargainsHoneiiHAOhannaWswqopGJXNOBRANDXIRQIHBMYNSFTDFACEMOONGenericBESTYASHNEWLABausch + LombTELOLYFOMIYESJIALIOUWalkersDOODLREAMEHJREMack'sLOLIPPYYDICOSMETICREFRESHGORGECRAFTWeiyan KJYwmsflINTERWARMPeltorCUTHOLLOWHONMEETTwinklemon3MOunonaCCOCCBreathe RightMOKKHNBGiaoneRENACLIPYQSTDGVPWSuperdantREOFLYUPEtereautySOFPLATEWEUVEBSystaneAmosfunDualoaiETHZZLEANATTASOULleorxKowoueSUPERFINDINGSELAYARDLITINKIMICRAFTYMELODYGazechimpAlasumChumsPandahallGMS OpticalDELORIGINTooyfulCOMBLOOMMAOKAPro EarsKONTONTYDolityPONABEADIYBLINKAoVoToTABLZONMURAGICPitycboSERENABLECroakiesOFFIGAMYardweLuxshinyQmerlimuiTDZTMNDNBBEAMARKERDesigniceLanemaOptipakCJBZLCPCOOJingyao WTUPGRATORacdancBulkSupplements.comGETAJGHSDPOPETPOPDEEPCRAFFKAKOWELYVosareaGOMAKERERLK LabWeloilleZEISSLuotYAHHUGloblelandRadiansRiouseryVyrtoWynterionHabitrolHealiftyOuliiPreserVisionBEUNITONEHobbspringJingtingOCuSOFTRugbyBenadrylFlentsNkeShengVaverenFINGERINSPIRELAZIOEGRNicehomfitNicoretteSignareSuodokaWRITWAAXirurusTheraTearsXanyeNiceautyNICERIOYajisiAHANDMAKERLIFKOMEColcoloLUMIFYMiumaeovTechToyHubYUNLIGHTSCTIRCHIUHukaiMAYJOYDIYMisrightMobestechM BuderSorority ShopGOOPESTRYNecviorOATIPHOBiotrueHOOWIFFYMobutofuSwansonHEATSHAKINGIbasetoyPEACOBLUEAooowerCOM1950sCAILDANLCIYISONColaxiLULULIONOcuviteRoaattaTIZUQEBAOPAICOOPHYAGeneralJZCHUNTOYStgfyxgsDebroxLEADINSM SunniMixSOIMISSAellinateyF FityleFyvusGLASSWINDSIMIKEYAPanda Superstore
Sort by|

Restock Essentials in Caregiver

Uses item details. Price when purchased online

SnoreMD Adjustable Anti-Snoring Aid for Restful Sleep $39.98

SnoreMD Adjustable Anti-Snoring Aid for Restful Sleep
Sponsored
current price $39.98
Options from $39.98 – $159.92

SnoreMD Adjustable Anti-Snoring Aid for Restful Sleep

3.9 out of 5 Stars. 685 reviews
Save with
Walmart Plus
Delivery as soon as 6am
Free shipping, arrives today
Free pickup as soon as 7am

Breathe Right Extra Strength Clear Nasal Strips, 44 Count for Relief of Nasal Congestion $15.83 Was $19.00 36.0 ¢/count

Breathe Right Extra Strength Clear Nasal Strips, 44 Count for Relief of Nasal Congestion
Sponsored
current price Now $15.83, Was $19.00
36.0 ¢/count
Options from $11.48

Breathe Right Extra Strength Clear Nasal Strips, 44 Count for Relief of Nasal Congestion

4.3 out of 5 Stars. 1267 reviews
Save with
Walmart Plus
Shipping arrives tomorrow

Rollback Blink NutriTears Vitamin and Supplement for Dry Eye Care and Vision Health with Lutein and Zeaxanthin Softgels, 50 Count $23.97 Was $29.97 47.9 ¢/count

Rollback
Blink NutriTears Vitamin and Supplement for Dry Eye Care and Vision Health with Lutein and Zeaxanthin Softgels, 50 Count
Sponsored
current price Now $23.97, Was $29.97
47.9 ¢/count

Blink NutriTears Vitamin and Supplement for Dry Eye Care and Vision Health with Lutein and Zeaxanthin Softgels, 50 Count

4.4 out of 5 Stars. 962 reviews
Save with
Walmart Plus
Delivery as soon as 6am
Shipping arrives today
Pickup as soon as 7am

Hostage Tape Pink Women's Mouth Tape 30 Count – for Nasal Breathing, Anti Snoring, Sleep Aid, Hypoallergenic, No Residue $16.99

Hostage Tape Pink Women's Mouth Tape 30 Count – for Nasal Breathing, Anti Snoring, Sleep Aid, Hypoallergenic, No Residue
Sponsored
current price $16.99

Hostage Tape Pink Women's Mouth Tape 30 Count – for Nasal Breathing, Anti Snoring, Sleep Aid, Hypoallergenic, No Residue

3.9 out of 5 Stars. 8 reviews
Save with
Walmart Plus
Shipping arrives Thu, Jul 9

ComfiTime 3D Sleep Mask - 100% Blackout Eye Mask for Sleeping, Eye Covers for Men,Women,Kids, Contour Blindfold with Nose Baffle, Soft & Lightweight Sleep Eye Blinders , Latex-Free, Black $8.82 Was $17.99

ComfiTime 3D Sleep Mask - 100% Blackout Eye Mask for Sleeping, Eye Covers for Men,Women,Kids, Contour Blindfold with Nose Baffle, Soft & Lightweight Sleep Eye Blinders , Latex-Free, Black
1-Black, variant on ComfiTime 3D Sleep Mask - 100% Blackout Eye Mask for Sleeping, Eye Covers for Men,Women,Kids, Contour Blindfold with Nose Baffle, Soft & Lightweight Sleep Eye Blinders , Latex-Free, Black
2-Silver Weaver Mesh, variant on ComfiTime 3D Sleep Mask - 100% Blackout Eye Mask for Sleeping, Eye Covers for Men,Women,Kids, Contour Blindfold with Nose Baffle, Soft & Lightweight Sleep Eye Blinders , Latex-Free, Black
3-Black Weaver Mesh, variant on ComfiTime 3D Sleep Mask - 100% Blackout Eye Mask for Sleeping, Eye Covers for Men,Women,Kids, Contour Blindfold with Nose Baffle, Soft & Lightweight Sleep Eye Blinders , Latex-Free, Black
4-Textured Black, variant on ComfiTime 3D Sleep Mask - 100% Blackout Eye Mask for Sleeping, Eye Covers for Men,Women,Kids, Contour Blindfold with Nose Baffle, Soft & Lightweight Sleep Eye Blinders , Latex-Free, Black
current price Now $8.82, Was $17.99
Options from $8.45

ComfiTime 3D Sleep Mask - 100% Blackout Eye Mask for Sleeping, Eye Covers for Men,Women,Kids, Contour Blindfold with Nose Baffle, Soft & Lightweight Sleep Eye Blinders , Latex-Free, Black

4.8 out of 5 Stars. 537 reviews
Save with
Walmart Plus
Shipping arrives tomorrow

Soft Contact Lens Inserter & Remover Kit with Case, 3-Piece Contact Applicator Natural Touch Removal Tool $11.99

Soft Contact Lens Inserter & Remover Kit with Case, 3-Piece Contact Applicator Natural Touch Removal Tool
current price $11.99

Soft Contact Lens Inserter & Remover Kit with Case, 3-Piece Contact Applicator Natural Touch Removal Tool

3.8 out of 5 Stars. 32 reviews
Save with
Walmart Plus
Shipping arrives tomorrow

Biotrue Original Multi-Purpose Contact Lens Solution and Cleaner with Lens Case, 4 fl oz $6.17 $1.54/fl oz

Biotrue Original Multi-Purpose Contact Lens Solution and Cleaner with Lens Case, 4 fl oz
Available in additional 4 sizes
current price $6.17
$1.54/fl oz
Options from $3.48

Biotrue Original Multi-Purpose Contact Lens Solution and Cleaner with Lens Case, 4 fl oz

4.8 out of 5 Stars. 13390 reviews
Save with
Walmart Plus
Shipping arrives tomorrow

Wally's Natural Unscented Paraffin Ear Candles, 2 pack $4.52 $2.26/count

Wally's Natural Unscented Paraffin Ear Candles, 2 pack
current price $4.52
$2.26/count

Wally's Natural Unscented Paraffin Ear Candles, 2 pack

4.3 out of 5 Stars. 546 reviews
Save with
Walmart Plus
Delivery as soon as 6am
Shipping arrives today
Pickup as soon as 7am

Best seller Visine Comfort Redness Reliever Red Eye Relief Drops, 0.5 fl oz $6.14 $12.28/fl oz

Best seller
Visine Comfort Redness Reliever Red Eye Relief Drops, 0.5 fl oz
Available in additional 2 options
current price $6.14
$12.28/fl oz
Options from $6.14 – $18.42

Visine Comfort Redness Reliever Red Eye Relief Drops, 0.5 fl oz

4.7 out of 5 Stars. 768 reviews
Save with
Walmart Plus
Delivery as soon as 6am
Shipping arrives today
Pickup as soon as 7am
View details for Caregiver essentials
Caregiver essentials
Caregiver essentials
Walkers & more to support their routine.

500+ bought since yesterday Equate Dairy Relief Lactase Enzyme Caplets, Original, 120 Count, Compare to Lactase Enzyme in Lactaid® Fast Act $9.48 7.9 ¢/count

500+ bought since yesterday
Equate Dairy Relief Lactase Enzyme Caplets, Original, 120 Count, Compare to Lactase Enzyme in Lactaid® Fast Act
Available in additional 2 options
current price $9.48
7.9 ¢/count
Options from $9.48 – $28.44

Equate Dairy Relief Lactase Enzyme Caplets, Original, 120 Count, Compare to Lactase Enzyme in Lactaid® Fast Act

4.6 out of 5 Stars. 3346 reviews
Save with
Walmart Plus
Delivery as soon as 6am
Shipping arrives today
Pickup as soon as 7am

Allegra Adult 24-Hour Allergy Relief Tablets, Non-Drowsy Indoor and Outdoor Allergy Medicine, 180 mg Fexofenadine HCI Antihistamine Pill, 70-Count $36.96 52.8 ¢/count

Allegra Adult 24-Hour Allergy Relief Tablets, Non-Drowsy Indoor and Outdoor Allergy Medicine, 180 mg Fexofenadine HCI Antihistamine Pill, 70-Count
Sponsored
current price $36.96
52.8 ¢/count

Allegra Adult 24-Hour Allergy Relief Tablets, Non-Drowsy Indoor and Outdoor Allergy Medicine, 180 mg Fexofenadine HCI Antihistamine Pill, 70-Count

4.7 out of 5 Stars. 5912 reviews
Save with
Walmart Plus
Free shipping, arrives tomorrow

Allegra Adult 24-Hour Allergy Relief Tablets, Non-Drowsy Indoor and Outdoor Allergy Medicine, 180 mg Fexofenadine HCI Antihistamine Pill, 15-Count $13.96 93.1 ¢/count

Allegra Adult 24-Hour Allergy Relief Tablets, Non-Drowsy Indoor and Outdoor Allergy Medicine, 180 mg Fexofenadine HCI Antihistamine Pill, 15-Count
Sponsored
current price $13.96
93.1 ¢/count

Allegra Adult 24-Hour Allergy Relief Tablets, Non-Drowsy Indoor and Outdoor Allergy Medicine, 180 mg Fexofenadine HCI Antihistamine Pill, 15-Count

4.7 out of 5 Stars. 5912 reviews
Save with
Walmart Plus
Delivery as soon as 6am
Shipping arrives today
Pickup as soon as 7am

GuruNanda Lavender Infused Mouth Tape with Travel Case for Sleeping -Breathable Strips - Reduce Snoring - 60 Pack $9.97 16.6 ¢/count

GuruNanda Lavender Infused Mouth Tape with Travel Case for Sleeping -Breathable Strips - Reduce Snoring - 60 Pack
Available in additional 2 options
current price $9.97
16.6 ¢/count
Options from $9.97 – $39.88

GuruNanda Lavender Infused Mouth Tape with Travel Case for Sleeping -Breathable Strips - Reduce Snoring - 60 Pack

4.3 out of 5 Stars. 120 reviews
Save with
Walmart Plus
Delivery as soon as 6am
Shipping arrives today
Pickup as soon as 7am

Debrox Ear Wax Removal Kit, Ear Cleaning Rubber Bulb Syringe and 0.5 fl oz Ear Wax Removal Drops $8.67 $17.34/fl oz

Debrox Ear Wax Removal Kit, Ear Cleaning Rubber Bulb Syringe and 0.5 fl oz Ear Wax Removal Drops
Available in additional 2 options
current price $8.67
$17.34/fl oz

Debrox Ear Wax Removal Kit, Ear Cleaning Rubber Bulb Syringe and 0.5 fl oz Ear Wax Removal Drops

4.4 out of 5 Stars. 1530 reviews
Save with
Walmart Plus
Delivery as soon as 6am
Shipping arrives today
Pickup as soon as 7am
View details for Wrap yourself in cozy comfort
Wrap yourself in cozy comfort
Wrap yourself in cozy comfort
Ease tension and stress away

Equate Formaldehyde-Free Diphenhydramine HCl 25mg Allergy Capsules, 100 Count $3.97 4.0 ¢/count

Equate Formaldehyde-Free Diphenhydramine HCl 25mg Allergy Capsules, 100 Count
Available in additional 2 options
current price $3.97
4.0 ¢/count
Options from $3.97 – $23.82

Equate Formaldehyde-Free Diphenhydramine HCl 25mg Allergy Capsules, 100 Count

4.8 out of 5 Stars. 12264 reviews
Save with
Walmart Plus
Delivery as soon as 6am
Shipping arrives today
Pickup as soon as 7am

Overall pick Equate Multi-Purpose Solution for Soft Contact Lenses, 24 fl oz (2x12 fl oz), Compare to Opti-Free Replenish $8.64 36.0 ¢/fl oz

Overall pick
Equate Multi-Purpose Solution for Soft Contact Lenses, 24 fl oz (2x12 fl oz), Compare to Opti-Free Replenish
Available in additional 3 options
current price $8.64
36.0 ¢/fl oz
Options from $8.64 – $17.28

Equate Multi-Purpose Solution for Soft Contact Lenses, 24 fl oz (2x12 fl oz), Compare to Opti-Free Replenish

4.8 out of 5 Stars. 2988 reviews
Save with
Walmart Plus
Delivery as soon as 6am
Pickup as soon as 7am

Debrox Ear Wax Removal Drops, Gentle Microfoam Ear Wax Remover, 0.5 fl oz $7.18 Was $9.49 $14.36/fl oz

Debrox Ear Wax Removal Drops, Gentle Microfoam Ear Wax Remover, 0.5 fl oz
Available in additional 2 options
current price Now $7.18, Was $9.49
$14.36/fl oz

Debrox Ear Wax Removal Drops, Gentle Microfoam Ear Wax Remover, 0.5 fl oz

4.5 out of 5 Stars. 1468 reviews
Save with
Walmart Plus
Delivery as soon as 6am
Shipping arrives today
Pickup as soon as 7am

Equate Eye Patch, Contoured Fit for Maximum Comfort, Black, 1 Count, One Size $4.98

Equate Eye Patch, Contoured Fit for Maximum Comfort, Black, 1 Count, One Size
current price $4.98

Equate Eye Patch, Contoured Fit for Maximum Comfort, Black, 1 Count, One Size

4.3 out of 5 Stars. 349 reviews
Save with
Walmart Plus
Delivery as soon as 6am
Shipping arrives today
Pickup as soon as 7am

Best seller Equate Adhesive Strip Anti-Snoring Nasal Strip for Snoring, Drug-Free, 26 Count $7.82 30.1 ¢/count

Best seller
Equate Adhesive Strip Anti-Snoring Nasal Strip for Snoring, Drug-Free, 26 Count
Available in additional 2 options
current price $7.82
30.1 ¢/count
Options from $7.82 – $23.46

Equate Adhesive Strip Anti-Snoring Nasal Strip for Snoring, Drug-Free, 26 Count

4.3 out of 5 Stars. 1816 reviews
Save with
Walmart Plus
Delivery as soon as 6am
Shipping arrives today
Pickup as soon as 7am

Bebird Ear Wax Remover Elite 14W, 14 Piece Kit with Storage Pouch $34.88

Bebird Ear Wax Remover Elite 14W, 14 Piece Kit with Storage Pouch
current price $34.88

Bebird Ear Wax Remover Elite 14W, 14 Piece Kit with Storage Pouch

4.4 out of 5 Stars. 61 reviews
Save with
Walmart Plus
Delivery as soon as 6am
Shipping arrives today
Pickup as soon as 7am

Allegra Hives Antihistamine 24-Hour Tablets, Non-Drowsy Hive Reduction and Hive Itch Relief, 180 mg Fexofenadine HCI, 30-Count $13.49 Was $24.49 45.0 ¢/count

Allegra Hives Antihistamine 24-Hour Tablets, Non-Drowsy Hive Reduction and Hive Itch Relief, 180 mg Fexofenadine HCI, 30-Count
Sponsored
current price Now $13.49, Was $24.49
45.0 ¢/count

Allegra Hives Antihistamine 24-Hour Tablets, Non-Drowsy Hive Reduction and Hive Itch Relief, 180 mg Fexofenadine HCI, 30-Count

4.6 out of 5 Stars. 1524 reviews
Save with
Walmart Plus
Shipping arrives Thu, Jul 9
Low stock

Rollback Allegra Adult 24-Hour Allergy Relief Tablets, Non-Drowsy Indoor and Outdoor Allergy Medicine, 180 mg Fexofenadine HCI Antihistamine Pill, 60-Count $27.96 Was $32.64 46.6 ¢/count

Rollback
Allegra Adult 24-Hour Allergy Relief Tablets, Non-Drowsy Indoor and Outdoor Allergy Medicine, 180 mg Fexofenadine HCI Antihistamine Pill, 60-Count
Sponsored
current price Now $27.96, Was $32.64
46.6 ¢/count
Options from $19.96

Allegra Adult 24-Hour Allergy Relief Tablets, Non-Drowsy Indoor and Outdoor Allergy Medicine, 180 mg Fexofenadine HCI Antihistamine Pill, 60-Count

4.7 out of 5 Stars. 5024 reviews
Save with
Walmart Plus
Delivery as soon as 6am
Shipping arrives today
Pickup as soon as 7am

Lipo Flavonoid Ear Pain Relief Drops with 4% Lidocaine, Fast Acting, 12.5mL $14.97 $35.64/fl oz

Lipo Flavonoid Ear Pain Relief Drops with 4% Lidocaine, Fast Acting, 12.5mL
Available in additional 2 options
current price $14.97
$35.64/fl oz
Options from $14.97 – $44.91

Lipo Flavonoid Ear Pain Relief Drops with 4% Lidocaine, Fast Acting, 12.5mL

4.5 out of 5 Stars. 630 reviews
Save with
Walmart Plus
Delivery as soon as 6am
Shipping arrives today
Pickup as soon as 7am

1K+ bought since yesterday Equate Sugar Free Fiber Supplement Powder, 17.6 oz, Compare to Benefiber® Prebiotic Fiber Content, 100% Natural $12.58 71.5 ¢/oz

1K+ bought since yesterday
Equate Sugar Free Fiber Supplement Powder, 17.6 oz, Compare to Benefiber® Prebiotic Fiber Content, 100% Natural
Available in additional 3 sizes
current price $12.58
71.5 ¢/oz
Options from $9.48

Equate Sugar Free Fiber Supplement Powder, 17.6 oz, Compare to Benefiber® Prebiotic Fiber Content, 100% Natural

4.7 out of 5 Stars. 7894 reviews
Save with
Walmart Plus
Delivery as soon as 6am
Shipping arrives today
Pickup as soon as 7am

Lactaid Fast Act Chewables, Pills for Lactose Intolerance, Vanilla Twist Flavor, 60 Count $27.84

Lactaid Fast Act Chewables, Pills for Lactose Intolerance, Vanilla Twist Flavor, 60 Count
Available in additional 2 options
current price $27.84
Options from $10.18

Lactaid Fast Act Chewables, Pills for Lactose Intolerance, Vanilla Twist Flavor, 60 Count

4.6 out of 5 Stars. 1569 reviews
Save with
Walmart Plus
Shipping arrives tomorrow
View details for Daily pill organizers
Daily pill organizers
Daily pill organizers
Stay on top of meds with an easier routine.

Best seller Flents Quiet Time® Soft Comfort Ear Plugs (NRR 33) (10 Pair) $3.57 35.7 ¢/count

Best seller
Flents Quiet Time® Soft Comfort Ear Plugs (NRR 33) (10 Pair)
current price $3.57
35.7 ¢/count

Flents Quiet Time® Soft Comfort Ear Plugs (NRR 33) (10 Pair)

4.5 out of 5 Stars. 2716 reviews
Save with
Walmart Plus
Delivery as soon as 6am
Shipping arrives today
Pickup as soon as 7am

Biotrue Hydration Plus Multi-Purpose Eye Contact Lens Solution and Cleaner for Soft Contacts, 4 fl oz $4.97 $1.24/fl oz

Biotrue Hydration Plus Multi-Purpose Eye Contact Lens Solution and Cleaner for Soft Contacts, 4 fl oz
Available in additional 2 options
current price $4.97
$1.24/fl oz

Biotrue Hydration Plus Multi-Purpose Eye Contact Lens Solution and Cleaner for Soft Contacts, 4 fl oz

4.7 out of 5 Stars. 900 reviews
Save with
Walmart Plus
Delivery as soon as 6am
Shipping arrives today
Pickup as soon as 7am

Pataday Extra Strength Eye Allergy Itch Relief Drops, 2.5 mL Twin Pack, Once Daily $31.96 $199.75/fl oz

Pataday Extra Strength Eye Allergy Itch Relief Drops, 2.5 mL Twin Pack, Once Daily
Available in additional 2 options
current price $31.96
$199.75/fl oz
Options from $31.96 – $57.53

Pataday Extra Strength Eye Allergy Itch Relief Drops, 2.5 mL Twin Pack, Once Daily

4.6 out of 5 Stars. 2487 reviews
Save with
Walmart Plus
Delivery as soon as 6am
Shipping arrives today
Pickup as soon as 7am

Best seller Equate, Liquid Ear Drops for Swimmers, 1 fl oz, Compare to Debrox® Active Ingredient $3.24 $3.24/fl oz

Best seller
Equate, Liquid Ear Drops for Swimmers, 1 fl oz, Compare to Debrox® Active Ingredient
Available in additional 2 options
current price $3.24
$3.24/fl oz
Options from $3.24 – $9.72

Equate, Liquid Ear Drops for Swimmers, 1 fl oz, Compare to Debrox® Active Ingredient

4.6 out of 5 Stars. 500 reviews
Save with
Walmart Plus
Delivery as soon as 6am
Shipping arrives today
Pickup as soon as 7am

Equate Uncoated Nicotine Gum 2 mg, Original Flavor, 220 Count Stop Smoking Aid $43.97 20.0 ¢/count

Equate Uncoated Nicotine Gum 2 mg, Original Flavor, 220 Count  Stop Smoking Aid
current price $43.97
20.0 ¢/count

Equate Uncoated Nicotine Gum 2 mg, Original Flavor, 220 Count Stop Smoking Aid

4.5 out of 5 Stars. 1343 reviews
Save with
Walmart Plus
Delivery as soon as 6am
Free shipping, arrives today
Free pickup as soon as 7am
Low stock
View details for Free 1-day delivery on Medline
Free 1-day delivery on Medline
Free 1-day delivery on Medline
Get chairs & more in as fast as 1 day. T&C apply.

Best seller Allegra Adult 24-Hour Allergy Relief Tablets, Non-Drowsy Indoor and Outdoor Allergy Medicine, 180 mg Fexofenadine HCI Antihistamine Pill, 90-Count $38.96 43.3 ¢/count

Best seller
Allegra Adult 24-Hour Allergy Relief Tablets, Non-Drowsy Indoor and Outdoor Allergy Medicine, 180 mg Fexofenadine HCI Antihistamine Pill, 90-Count
Sponsored
current price $38.96
43.3 ¢/count

Allegra Adult 24-Hour Allergy Relief Tablets, Non-Drowsy Indoor and Outdoor Allergy Medicine, 180 mg Fexofenadine HCI Antihistamine Pill, 90-Count

4.7 out of 5 Stars. 5024 reviews
Save with
Walmart Plus
Delivery as soon as 6am
Free shipping, arrives today
Free pickup as soon as 7am

Pataday Extra Strength Eye Allergy Itch Relief Drops, 2.5 mL Twin Pack, Once Daily $31.96 $199.75/fl oz

Pataday Extra Strength Eye Allergy Itch Relief Drops, 2.5 mL Twin Pack, Once Daily
Sponsored
current price $31.96
$199.75/fl oz
Options from $31.96 – $57.53

Pataday Extra Strength Eye Allergy Itch Relief Drops, 2.5 mL Twin Pack, Once Daily

4.6 out of 5 Stars. 2487 reviews
Save with
Walmart Plus
Delivery as soon as 6am
Shipping arrives today
Pickup as soon as 7am

Systane Nighttime Lubricant Eye Ointment for Dry Eye Relief, 3.5g Tube for Adults $14.48 $111.39/oz

Systane Nighttime Lubricant Eye Ointment for Dry Eye Relief, 3.5g Tube for Adults
Available in additional 2 options
current price $14.48
$111.39/oz
Options from $14.48 – $43.44

Systane Nighttime Lubricant Eye Ointment for Dry Eye Relief, 3.5g Tube for Adults

4.6 out of 5 Stars. 1472 reviews
Save with
Walmart Plus
Delivery as soon as 6am
Shipping arrives today
Pickup as soon as 7am
Low stock

Equate Contact Lens Cases, 1 Count $1.58

Equate Contact Lens Cases, 1 Count
current price $1.58

Equate Contact Lens Cases, 1 Count

4.7 out of 5 Stars. 253 reviews
Save with
Walmart Plus
Delivery as soon as 6am
Shipping arrives today
Pickup as soon as 7am

IBgard Gut Health Supplement, Peppermint Oil Capsules for Abdominal Comfort, 48 Capsules $29.97

IBgard Gut Health Supplement, Peppermint Oil Capsules for Abdominal Comfort, 48 Capsules
Available in additional 2 options
current price $29.97

IBgard Gut Health Supplement, Peppermint Oil Capsules for Abdominal Comfort, 48 Capsules

4.6 out of 5 Stars. 1061 reviews
Save with
Walmart Plus
Delivery as soon as 6am
Shipping arrives today
Pickup as soon as 7am

OPTI-FREE Puremoist All Day Comfort Contact Lens Cleaning Solution Trial Kit for Daily Use, 2 fl oz $7.90 $3.95/fl oz

OPTI-FREE Puremoist All Day Comfort Contact Lens Cleaning Solution Trial Kit for Daily Use, 2 fl oz
Available in additional 2 options
current price $7.90
$3.95/fl oz
Options from $7.90 – $10.59

OPTI-FREE Puremoist All Day Comfort Contact Lens Cleaning Solution Trial Kit for Daily Use, 2 fl oz

4.8 out of 5 Stars. 268 reviews
Free shipping, arrives Fri, Jul 10

Refresh Tears Lubricant Eye Drops Artificial Tears, 30 ml, 2 Bottles $14.78 $14.78/fl oz

Refresh Tears Lubricant Eye Drops Artificial Tears, 30 ml, 2 Bottles
Available in additional 2 options
current price $14.78
$14.78/fl oz
Options from $10.68

Refresh Tears Lubricant Eye Drops Artificial Tears, 30 ml, 2 Bottles

4.7 out of 5 Stars. 6988 reviews
Save with
Walmart Plus
Delivery as soon as 6am
Shipping arrives today
Pickup as soon as 7am

Equate Coated Nicotine Gum 2 mg, Fruit Flavor, 200 Count – Stop Smoking Aid $43.97 22.0 ¢/count

Equate Coated Nicotine Gum 2 mg, Fruit Flavor, 200 Count – Stop Smoking Aid
Available in additional 2 options
current price $43.97
22.0 ¢/count

Equate Coated Nicotine Gum 2 mg, Fruit Flavor, 200 Count – Stop Smoking Aid

4.6 out of 5 Stars. 1397 reviews
Save with
Walmart Plus
Delivery as soon as 6am
Free shipping, arrives today
Free pickup as soon as 7am

Renu Multipurpose Eye Contact Lens Solution and Cleaner with Lens Case for Soft Lenses, 12 fl oz, 2 Pack $14.96 62.3 ¢/fl oz

Renu Multipurpose Eye Contact Lens Solution and Cleaner with Lens Case for Soft Lenses, 12 fl oz, 2 Pack
current price $14.96
62.3 ¢/fl oz

Renu Multipurpose Eye Contact Lens Solution and Cleaner with Lens Case for Soft Lenses, 12 fl oz, 2 Pack

4.8 out of 5 Stars. 774 reviews
Save with
Walmart Plus
Delivery as soon as 6am
Shipping arrives today
Pickup as soon as 7am

iVIZIA Dry Eye Drops, Preservative-Free, 10ml Bottle $12.26 $37.15/fl oz

iVIZIA Dry Eye Drops, Preservative-Free, 10ml Bottle
Available in additional 2 options
current price $12.26
$37.15/fl oz
Options from $12.26 – $36.78

iVIZIA Dry Eye Drops, Preservative-Free, 10ml Bottle

4.7 out of 5 Stars. 1382 reviews
Save with
Walmart Plus
Delivery as soon as 6am
Shipping arrives today
Pickup as soon as 7am

Children's Benadryl Dye-Free Allergy Liquid, Bubble Gum, 8 fl. oz $10.44 $1.31/fl oz

Children's Benadryl Dye-Free Allergy Liquid, Bubble Gum, 8 fl. oz
Available in additional 3 sizes
current price $10.44
$1.31/fl oz
Options from $8.28

Children's Benadryl Dye-Free Allergy Liquid, Bubble Gum, 8 fl. oz

4.8 out of 5 Stars. 2658 reviews
Save with
Walmart Plus
Delivery as soon as 6am
Shipping arrives today
Pickup as soon as 7am

500+ bought since yesterday Gaviscon Extra Strength Chewable Antacid Tablets for Heartburn Relief, 100 Count $10.18 10.2 ¢/count

500+ bought since yesterday
Gaviscon Extra Strength Chewable Antacid Tablets for Heartburn Relief, 100 Count
current price $10.18
10.2 ¢/count

Gaviscon Extra Strength Chewable Antacid Tablets for Heartburn Relief, 100 Count

4.7 out of 5 Stars. 1929 reviews
Save with
Walmart Plus
Delivery as soon as 6am
Shipping arrives today
Pickup as soon as 7am
Low stock

Rollback Flonase Sensimist Nasal Spray Non-Drowsy Decongestant Severe Allergy Relief Medicine, 60 Sprays $14.88 Was $17.48 $74.40/fl oz

Rollback
Flonase Sensimist Nasal Spray Non-Drowsy Decongestant Severe Allergy Relief Medicine, 60 Sprays
current price Now $14.88, Was $17.48
$74.40/fl oz

Flonase Sensimist Nasal Spray Non-Drowsy Decongestant Severe Allergy Relief Medicine, 60 Sprays

4.6 out of 5 Stars. 3703 reviews
Save with
Walmart Plus
Delivery as soon as 6am
Shipping arrives today
Pickup as soon as 7am

Equate Ultra Soft Foam Earplugs, 32dB Noise Reduction Rating, 12 Pairs $3.44 28.7 ¢/count

Equate Ultra Soft Foam Earplugs, 32dB Noise Reduction Rating, 12 Pairs
current price $3.44
28.7 ¢/count

Equate Ultra Soft Foam Earplugs, 32dB Noise Reduction Rating, 12 Pairs

4.2 out of 5 Stars. 933 reviews
Save with
Walmart Plus
Delivery as soon as 6am
Shipping arrives today
Pickup as soon as 7am

Equate Gluten-Free Cetirizine Allergy Medicine Tablets 10mg 300 Count $20.88 7.0 ¢/count

Equate Gluten-Free Cetirizine Allergy Medicine Tablets 10mg 300 Count
Available in additional 6 options
current price $20.88
7.0 ¢/count
Options from $2.98

Equate Gluten-Free Cetirizine Allergy Medicine Tablets 10mg 300 Count

4.7 out of 5 Stars. 24049 reviews
Save with
Walmart Plus
Delivery as soon as 6am
Shipping arrives today
Pickup as soon as 7am

Equate Dry Eye Relief Lubricant Eye Drops, 0.5 fl oz, Compare to Bausch + Lomb Advanced Eye Relief Dry Eye $5.97 $11.94/fl oz

Equate Dry Eye Relief Lubricant Eye Drops, 0.5 fl oz, Compare to Bausch + Lomb Advanced Eye Relief Dry Eye
Available in additional 2 options
current price $5.97
$11.94/fl oz
Options from $5.97 – $11.94

Equate Dry Eye Relief Lubricant Eye Drops, 0.5 fl oz, Compare to Bausch + Lomb Advanced Eye Relief Dry Eye

4.6 out of 5 Stars. 5915 reviews
Save with
Walmart Plus
Delivery as soon as 6am
Shipping arrives today
Pickup as soon as 7am

ZEISS Gentle and Thorough Cleaning Eyeglass Lens Cleaner Wipes, 100 Count $5.78 Was $15.99 $5.78/100 ct

ZEISS Gentle and Thorough Cleaning Eyeglass Lens Cleaner Wipes, 100 Count
Available in additional 2 options
current price Now $5.78, Was $15.99
$5.78/100 ct
Options from $5.78 – $11.56

ZEISS Gentle and Thorough Cleaning Eyeglass Lens Cleaner Wipes, 100 Count

4.8 out of 5 Stars. 7670 reviews
Save with
Walmart Plus
Delivery as soon as 6am
Shipping arrives today
Pickup as soon as 7am

Mack's Pillow Soft Silicone Earplugs - 6 Pair $3.83 63.8 ¢/count

Mack's Pillow Soft Silicone Earplugs - 6 Pair
Available in additional 2 options
current price $3.83
63.8 ¢/count
Options from $3.83 – $11.49

Mack's Pillow Soft Silicone Earplugs - 6 Pair

4.5 out of 5 Stars. 1646 reviews
Save with
Walmart Plus
Delivery as soon as 6am
Pickup as soon as 7am

The Relief Products, Natural Ears, Ring Relief Ear Drops, Tinnitus Symptoms such as Ear Ringing, 1 Count, 0.33 fl oz $7.88 $23.88/fl oz

The Relief Products, Natural Ears, Ring Relief Ear Drops, Tinnitus Symptoms such as Ear Ringing, 1 Count, 0.33 fl oz
Available in additional 2 options
current price $7.88
$23.88/fl oz
Options from $7.88 – $23.64

The Relief Products, Natural Ears, Ring Relief Ear Drops, Tinnitus Symptoms such as Ear Ringing, 1 Count, 0.33 fl oz

3.9 out of 5 Stars. 548 reviews
Save with
Walmart Plus
Delivery as soon as 6am
Shipping arrives today
Pickup as soon as 7am

Xyzal 24 Hour Allergy Relief Medicine, Original Prescription Strength Antihistamine, Levocetirizine Dihydrochloride Tablets, 5 mg, 10 Count $7.97 79.7 ¢/count

Xyzal 24 Hour Allergy Relief Medicine, Original Prescription Strength Antihistamine, Levocetirizine Dihydrochloride Tablets, 5 mg, 10 Count
current price $7.97
79.7 ¢/count

Xyzal 24 Hour Allergy Relief Medicine, Original Prescription Strength Antihistamine, Levocetirizine Dihydrochloride Tablets, 5 mg, 10 Count

4.5 out of 5 Stars. 11556 reviews
Save with
Walmart Plus
Delivery as soon as 6am
Shipping arrives today
Pickup as soon as 7am

About Restock Essentials in Caregiver - Walmart.com

Restock essentials help you rebuild your medicine cabinet with the health and wellness basics your household reaches for frequently. You can use this page to compare everyday replenishment needs across vitamins, pain relief, first aid, and cough and cold supplies.

How to choose restock essentials for your household

You can start with the product category your home uses frequently during weekly routines and seasonal changes. You should consider whether you need vitamins, pain relief items, first aid supplies, or cough and cold basics first.

Your next step is matching each item to the people in your home and the way they prefer to use it. You may compare tablets, capsules, liquids, and creams based on comfort, convenience, and daily habits.

You can narrow your options quickly when you look at a few practical decisions before refilling your cabinet. You may want to compare these details first:

  • You can choose vitamins when your routine includes daily wellness replenishment and repeat use.
  • You can choose pain relief formats when your cabinet needs common comfort staples in easy-to-find packs.
  • You can choose first aid restock items when your household uses bandages, gauze, ointments, or cleaning supplies regularly.
  • You can choose cough and cold basics when you want your cabinet ready for seasonal needs and changing routines.
  • You can compare travel size, standard pack, and family size options to match how quickly your household uses each item.

Choosing product categories for a medicine cabinet restock

You should think about your medicine cabinet restock in groups, because each category serves a different household purpose. You can keep daily routines organized when each shelf has a clear role.

For vitamins, you may look for formats that fit your schedule and age group needs. You can compare adults, kids, infants, and seniors options based on labeled use and serving style.

For pain relief, you should check active ingredient strength and compare it in plain terms across available choices. You can use those details to see whether a lower or higher strength fits your usual cabinet plan.

With first aid restock items, you may focus on basics that support quick cleanup and clear organization. You can keep bandages, adhesive tape, gauze, and creams together so your cabinet stays easy to manage.

For cough and cold supplies, you should compare liquid and tablet options by household preference and storage space. You can also separate daytime and nighttime formats when your routine calls for distinct options.

What to look for in forms, sizes, and labels

You can use form as a simple decision point when several items meet the same need. You may prefer tablets or capsules for compact storage, while liquids and creams can feel easy to use in certain situations.

Your pack size should match how often your household reaches for each category throughout the month. You can choose travel size for bags and quick access, standard pack for steady use, or family size for shared cabinets.

You should also check batch codes and expiration details when you build your restock essentials list. You can use shelf life information to rotate older items forward and keep newer items organized.

When you compare labels, you may notice active ingredient strength listed clearly on the front or back panel. You can use that information to understand the amount in each dose without relying only on brand familiarity.

You should measure cabinet space before choosing larger packs or multiple formats in the same category. You can keep your shelves easy to sort when bottles, boxes, and tubes fit your storage plan.

Matching restock essentials to adults, kids, infants, and seniors

You can build a highly functional cabinet when you sort products by the people who use them frequently. You should check age-specific labeling so your household setup stays clear and easy to follow.

For adults, you may prioritize daily vitamins, standard pain relief packs, and first aid basics for home and work routines. You can keep tablets or capsules nearby when compact storage matters.

For kids, you might look for liquids or other easy-to-administer formats that fit family routines and labeled age ranges. You can pair those picks with bandages and gentle first aid basics for active days.

For infants, you should focus on clearly labeled options and smaller formats that fit diaper bags or nursery storage. You can keep travel size items nearby when you want quick access away from the main cabinet.

For seniors, you may want larger print labels, familiar forms, and refill sizes that reduce frequent replacement. You can compare standard pack and family size options based on steady household use.

Using health and wellness essentials through the year

You can treat health and wellness essentials as a seasonal checklist instead of a one-time task. You may refresh vitamins and daily items regularly, then update first aid and cough and cold supplies as routines shift.

During travel periods, you can use smaller formats that fit purses, backpacks, or luggage without taking much room. You should keep your main cabinet stocked separately, so your home supply stays complete.

For busy family schedules, you can organize by category and form so each item stays easy to spot. You may place creams with first aid, liquids together on one shelf, and tablets or capsules in another section.

When your household changes, you can adjust pack size and user group choices without rebuilding your whole setup. You can keep your restock essentials practical by reviewing what your home actually uses each month.

Your cabinet works harder when you choose restock essentials with clear categories, useful formats, and pack sizes that fit real routines. You can keep daily wellness, first aid, and seasonal basics ready with less guesswork.