Expert GrillMiboteBN-LINKCOWINBlackstoneNULASRomanticistConsiwaWay To CelebratePARGRILLHome-CompleteABABENYWalchoiceFarberwarePOLIGOMainstaysyankucatMikhaikibhousgrilljoyLotFancyCshidworldArooickTTempProKtaxonOXOBackyard DiscoveryPit BosscyricoDARZUWeberHandyCharbroilTANGKAMOJMBSBYPermasteelChar-GrillerTanbabyUnbrandedGVDVGoodCookHavenityBOIVSHIAdviaceCuisinartOutsetCaron & DoucetDOQAUSYQSDGReaNeaQuickflameMr. Bar-B-QLumivoraCacagooBSI ProductsBaseball BBQArizona CardinalsMorfoneWOFOSLOTDOGMolten MastersMountain GrillersGARITINSagemeDY DECENT FAMILYOHHANICitruSafeOld SmokeyKOYMISKUGrill ZoneMusic City MetalsNexgrillAppliance Factory PartsNOBRANDStove & Grill Parts For LessUpStart ComponentsBroilmasterHenny PennySouthbend RangeNapoleonPASILIGarland RugsLandmann USATHWXAFrymasterIDNASRT Appliance PartsUxcellYafixFEOLGEHLYSufanicMHPContemporary Home LivingTAPDRATraeger Pellet GrillsGarlandsailesitiGenericaoqianlanAoqianlanMhp PartsTarmeekacdancPitcoJUANCHENGCenter VYIMINGHaoweiGrillPitycboBertazzoniCleveland TubingLOLIPPYYVivaVaultWhirlpoolImperialGroenHobart WeldersQmerlimuiColaxiGrillmarkLylongOunonaRaindropsTIZUQE///ATALRPOUBakers PrideBerkelCaraMartGeneralJIAHAOOleorxLianggggzyuMilistenAllPoints FoodserviceAymzbdDIYDukeGrillProJoyMagicLYPinggggMavrikNapoleon GrillOuliiWolfAPPLAYERRELAYARDFisher & PaykelFOMIYESJadeLABSERRONOnward Manufacturing CompanyPhenoficeRoohaStarYlsvtARCADORABlodgettCSYANXINGGUYUTINGJCLMERLITINKIMIQSTDGVPWRENACLIPYREOFLYUPSDFGTstoreSmile HomeSpringVollrathVulcan-HartWHAMVOXZWILLINGAmerican RangeAPW WyottArkzeoBBQTEKBlakesleeBroil KingFHBVTFQIBHUGFzaqwenGrillers ChoiceHtanchJim BeamKqbmzfrMajestic HearthMeatenderMOPOORMTBLYSOutdoor Living and StylePerfect FrypvnsdweQholemyoSunyuuuuuUniversal Grill PartsWEUVEBWJYyotijay24/7PARTSINC
Sort by|

Grill Tool Sets in Grill Tools & Utensils

Uses item details. Price when purchased online

Best seller NULAS 27Pcs Griddle Accessories Kit with Spatula & Burger Press, Flat Top Grill Tools for Blackstone Outdoor BBQ

Best seller
NULAS 27Pcs Griddle Accessories Kit with Spatula & Burger Press, Flat Top Grill Tools for Blackstone Outdoor BBQ
Sponsored
Now$2999$119.99You save$90.00
NULAS 27Pcs Griddle Accessories Kit with Spatula & Burger Press, Flat Top Grill Tools for Blackstone Outdoor BBQ
4.6 out of 5 Stars. 73 reviews
Save withWalmart plus
Shipping, arrives tomorrow

Best seller Mibote Stainless Steel Griddle Accessories Kit with Spatula, Scraper, Basting Cover & Grill Tools

Best seller
Mibote Stainless Steel Griddle Accessories Kit with Spatula, Scraper, Basting Cover & Grill Tools
Sponsored
Now$2899$59.99You save$31.00
Mibote Stainless Steel Griddle Accessories Kit with Spatula, Scraper, Basting Cover & Grill Tools
4.7 out of 5 Stars. 752 reviews
Save withWalmart plus
Shipping, arrives Wed, Jul 29

PARGRILL BBQ Accessories Set – Heavy Duty Stainless Steel Spatula, Fork, Brush and Tongs, Essential Barbecue Tool Kit for Outdoor Cooking and Grilling Lovers

PARGRILL BBQ Accessories Set – Heavy Duty Stainless Steel Spatula, Fork, Brush and Tongs, Essential Barbecue Tool Kit for Outdoor Cooking and Grilling Lovers
Sponsored
Now$2299$33.99You save$11.00
PARGRILL BBQ Accessories Set – Heavy Duty Stainless Steel Spatula, Fork, Brush and Tongs, Essential Barbecue Tool Kit for Outdoor Cooking and Grilling Lovers
5 out of 5 Stars. 23 reviews
Save withWalmart plus
Shipping, arrives tomorrow

Griddle Accessories Kit 140 Pcs for Blackstone Camp Chef Professional Griddle Grill BBQ Spatula

Griddle Accessories Kit 140 Pcs for Blackstone Camp Chef Professional Griddle Grill BBQ Spatula
Sponsored
Now$2899$52.99You save$24.00Options from $26.60
Griddle Accessories Kit 140 Pcs for Blackstone Camp Chef Professional Griddle Grill BBQ Spatula
4.5 out of 5 Stars. 2548 reviews
Save withWalmart plus
Shipping, arrives tomorrow

Overall pick Expert Gril Grilling Accessories BBQ Grill Tools Set, 3 Pieces Stainless Steel Grill Kit

Overall pick
Expert Gril Grilling Accessories BBQ Grill Tools Set, 3 Pieces Stainless Steel Grill Kit
Available in additional 2 options
$1397Options from $13.97 – $55.88
Expert Gril Grilling Accessories BBQ Grill Tools Set, 3 Pieces Stainless Steel Grill Kit
4.7 out of 5 Stars. 573 reviews
Save withWalmart plus
Delivery as soon as 25 minsShipping, arrives tomorrowPickup as soon as tomorrow

Best seller BBQ Grill Accessories Set, 38Pcs Stainless Steel Grill Tools Grilling Accessories with Aluminum Case

Best seller
BBQ Grill Accessories Set, 38Pcs Stainless Steel Grill Tools Grilling Accessories with Aluminum Case
Black, variant on BBQ Grill Accessories Set, 38Pcs Stainless Steel Grill Tools Grilling Accessories with Aluminum Case
Brown, variant on BBQ Grill Accessories Set, 38Pcs Stainless Steel Grill Tools Grilling Accessories with Aluminum Case
silver, variant on BBQ Grill Accessories Set, 38Pcs Stainless Steel Grill Tools Grilling Accessories with Aluminum Case
Now$2996$35.99You save$6.03Options from $29.96 – $29.99
BBQ Grill Accessories Set, 38Pcs Stainless Steel Grill Tools Grilling Accessories with Aluminum Case
4.6 out of 5 Stars. 598 reviews
Save withWalmart plus
Shipping, arrives tomorrow

Expert Grill Grilling Accessories BBQ Grill Tools Set, 10 Pieces Stainless Steel Grill Kit

Expert Grill Grilling Accessories BBQ Grill Tools Set, 10 Pieces Stainless Steel Grill Kit
$2497
Expert Grill Grilling Accessories BBQ Grill Tools Set, 10 Pieces Stainless Steel Grill Kit
4.7 out of 5 Stars. 747 reviews
Save withWalmart plus
Delivery as soon as 25 minsShipping, arrives tomorrowPickup as soon as tomorrow

BN-LINK 20pcs BBQ Grill BBQ Accessories, Stainless Steel Grill Tools Set with Carry Bag,Barbecue Grill Accessories,BBQ Utensils,Camping & Tailgating

BN-LINK 20pcs BBQ Grill BBQ Accessories, Stainless Steel Grill Tools Set with Carry Bag,Barbecue Grill Accessories,BBQ Utensils,Camping & Tailgating
$1999
BN-LINK 20pcs BBQ Grill BBQ Accessories, Stainless Steel Grill Tools Set with Carry Bag,Barbecue Grill Accessories,BBQ Utensils,Camping & Tailgating
4.9 out of 5 Stars. 7 reviews
Save withWalmart plus
Shipping, arrives tomorrow

Home-Complete 18-Piece Wood and Stainless-Steel BBQ Grill Set with Case

Home-Complete 18-Piece Wood and Stainless-Steel BBQ Grill Set with Case
$1559
Home-Complete 18-Piece Wood and Stainless-Steel BBQ Grill Set with Case
3.9 out of 5 Stars. 119 reviews
Save withWalmart plus
Shipping, arrives Wed, Jul 29
View details for Top-brand grilling fuel
Top-brand grilling fuel
Top-brand grilling fuel
Big flavor, small price.

ROMANTICIST 20pcs Professional BBQ Accessories Set - Heavy-Duty Stainless Steel Grill Tool Kit, Perfect Holiday Gift for Christmas & Fall & Winter Grilling, Camping & Family Gatherings

ROMANTICIST 20pcs Professional BBQ Accessories Set - Heavy-Duty Stainless Steel Grill Tool Kit, Perfect Holiday Gift for Christmas & Fall & Winter Grilling, Camping & Family Gatherings
black, variant on ROMANTICIST 20pcs Professional BBQ Accessories Set - Heavy-Duty Stainless Steel Grill Tool Kit, Perfect Holiday Gift for Christmas & Fall & Winter Grilling, Camping & Family Gatherings
gray, variant on ROMANTICIST 20pcs Professional BBQ Accessories Set - Heavy-Duty Stainless Steel Grill Tool Kit, Perfect Holiday Gift for Christmas & Fall & Winter Grilling, Camping & Family Gatherings
silvery, variant on ROMANTICIST 20pcs Professional BBQ Accessories Set - Heavy-Duty Stainless Steel Grill Tool Kit, Perfect Holiday Gift for Christmas & Fall & Winter Grilling, Camping & Family Gatherings
Now$2099$23.99You save$3.00Options from $19.76
ROMANTICIST 20pcs Professional BBQ Accessories Set - Heavy-Duty Stainless Steel Grill Tool Kit, Perfect Holiday Gift for Christmas & Fall & Winter Grilling, Camping & Family Gatherings
4.8 out of 5 Stars. 288 reviews
Save withWalmart plus
Shipping, arrives Wed, Jul 29

Char-Griller Magnetic Tool Hooks for Grill (3-Pack) - Stainless Steel Grill Tool Holder - Magnetic Hooks for Grill Tools, BBQ Utensils, Griddle Tool Holder

Char-Griller Magnetic Tool Hooks for Grill (3-Pack) - Stainless Steel Grill Tool Holder - Magnetic Hooks for Grill Tools, BBQ Utensils, Griddle Tool Holder
Sponsored
$1234
Char-Griller Magnetic Tool Hooks for Grill (3-Pack) - Stainless Steel Grill Tool Holder - Magnetic Hooks for Grill Tools, BBQ Utensils, Griddle Tool Holder
4.9 out of 5 Stars. 7 reviews
Free shipping, arrives in 3+ days

ROMANTICIST 20pcs Professional BBQ Accessories Set - Heavy-Duty Stainless Steel Grill Tool Kit, Perfect Holiday Gift for Christmas & Fall & Winter Grilling, Camping & Family Gatherings

ROMANTICIST 20pcs Professional BBQ Accessories Set - Heavy-Duty Stainless Steel Grill Tool Kit, Perfect Holiday Gift for Christmas & Fall & Winter Grilling, Camping & Family Gatherings
Sponsored
Now$1976$21.99You save$2.23Options from $19.76 – $20.99
ROMANTICIST 20pcs Professional BBQ Accessories Set - Heavy-Duty Stainless Steel Grill Tool Kit, Perfect Holiday Gift for Christmas & Fall & Winter Grilling, Camping & Family Gatherings
4.8 out of 5 Stars. 288 reviews
Save withWalmart plus
Shipping, arrives Wed, Jul 29

Expert Grill Grilling Accessories BBQ Grill Tools Set, 4 Pieces Stainless Steel Grill Kit

Expert Grill Grilling Accessories BBQ Grill Tools Set, 4 Pieces Stainless Steel Grill Kit
$1997
Expert Grill Grilling Accessories BBQ Grill Tools Set, 4 Pieces Stainless Steel Grill Kit
4.8 out of 5 Stars. 155 reviews
Save withWalmart plus
Delivery as soon as 25 minsShipping, arrives tomorrowPickup as soon as tomorrow

Best seller Mibote Stainless Steel Griddle Accessories Kit with Spatula, Scraper, Basting Cover & Grill Tools

Best seller
Mibote Stainless Steel Griddle Accessories Kit with Spatula, Scraper, Basting Cover & Grill Tools
Available in additional 2 options
Now$2899$59.99You save$31.00
Mibote Stainless Steel Griddle Accessories Kit with Spatula, Scraper, Basting Cover & Grill Tools
4.7 out of 5 Stars. 752 reviews
Save withWalmart plus
Shipping, arrives Wed, Jul 29
View details for Top tools for grilling pros
Top tools for grilling pros
Top tools for grilling pros
Easy prep, simple cleanup.

Rollback Blackstone Ultimate Griddle Kit, 25-Piece

Rollback
Blackstone Ultimate Griddle Kit, 25-Piece
Now$5996$69.00You save$9.04
Blackstone Ultimate Griddle Kit, 25-Piece
4.6 out of 5 Stars. 546 reviews
Save withWalmart plus
Free shipping, arrives tomorrowPickup at a 

ArooickT Grill Tools Set,7 Pieces Stainless Steel Grill Kit with Case, Barbecue Utensil Tool

ArooickT Grill Tools Set,7 Pieces Stainless Steel Grill Kit with Case, Barbecue Utensil Tool
Available in additional 2 options
$1699Options from $16.99 – $17.99
ArooickT Grill Tools Set,7 Pieces Stainless Steel Grill Kit with Case, Barbecue Utensil Tool
4.8 out of 5 Stars. 9 reviews
Save withWalmart plus
Shipping, arrives Thu, Jul 30

Griddle Accessories Kit 140 Pcs for Blackstone Camp Chef Professional Griddle Grill BBQ Spatula

Griddle Accessories Kit 140 Pcs for Blackstone Camp Chef Professional Griddle Grill BBQ Spatula
Available in additional 2 options
Now$2899$52.99You save$24.00Options from $26.60
Griddle Accessories Kit 140 Pcs for Blackstone Camp Chef Professional Griddle Grill BBQ Spatula
4.5 out of 5 Stars. 2548 reviews
Save withWalmart plus
Shipping, arrives tomorrow

Best seller NULAS 27Pcs Griddle Accessories Kit with Spatula & Burger Press, Flat Top Grill Tools for Blackstone Outdoor BBQ

Best seller
NULAS 27Pcs Griddle Accessories Kit with Spatula & Burger Press, Flat Top Grill Tools for Blackstone Outdoor BBQ
Now$2999$119.99You save$90.00
NULAS 27Pcs Griddle Accessories Kit with Spatula & Burger Press, Flat Top Grill Tools for Blackstone Outdoor BBQ
4.6 out of 5 Stars. 73 reviews
Save withWalmart plus
Shipping, arrives tomorrow

Best seller Mainstays 3-Piece Stainless Steel Barbecue Grill Tool Set

Best seller
Mainstays 3-Piece Stainless Steel Barbecue Grill Tool Set
$1378
Mainstays 3-Piece Stainless Steel Barbecue Grill Tool Set
4.4 out of 5 Stars. 151 reviews
Save withWalmart plus
Delivery as soon as 25 minsShipping, arrives tomorrowPickup as soon as tomorrow

PARGRILL BBQ Accessories Set Heavy Duty Stainless Steel Spatula, Fork, Brush and Tongs, Essential Barbecue Tool Kit for Outdoor Cooking and Grilling Lovers

PARGRILL BBQ Accessories Set  Heavy Duty Stainless Steel Spatula, Fork, Brush and Tongs, Essential Barbecue Tool Kit for Outdoor Cooking and Grilling Lovers
Now$2299$33.99You save$11.00
PARGRILL BBQ Accessories Set Heavy Duty Stainless Steel Spatula, Fork, Brush and Tongs, Essential Barbecue Tool Kit for Outdoor Cooking and Grilling Lovers
5 out of 5 Stars. 23 reviews
Save withWalmart plus
Shipping, arrives tomorrow

Yankucat Electric Grill Brush for Outdoor Grill - Cordless Rechargeable BBQ Cleaner with 304 Stainless Steel, 4000mAh Power Rotary Grill Cleaning Brush for Gas Charcoal Grates

Yankucat Electric Grill Brush for Outdoor Grill - Cordless Rechargeable BBQ Cleaner with 304 Stainless Steel, 4000mAh Power Rotary Grill Cleaning Brush for Gas Charcoal Grates
Sponsored
Now$4999$78.99You save$29.00
Yankucat Electric Grill Brush for Outdoor Grill - Cordless Rechargeable BBQ Cleaner with 304 Stainless Steel, 4000mAh Power Rotary Grill Cleaning Brush for Gas Charcoal Grates
4.4 out of 5 Stars. 16 reviews
Save withWalmart plus
Free shipping, arrives Wed, Jul 29

21 Pieces Complete Grill Accessories Kit, Very Best Grill Gift on Birthday Wedding - Professional BBQ Accessories Set for Outdoor Camping Grilling

21 Pieces Complete Grill Accessories Kit, Very Best Grill Gift on Birthday Wedding - Professional BBQ Accessories Set for Outdoor Camping Grilling
Sponsored
Now$2249$39.99You save$17.50
21 Pieces Complete Grill Accessories Kit, Very Best Grill Gift on Birthday Wedding - Professional BBQ Accessories Set for Outdoor Camping Grilling
4.6 out of 5 Stars. 86 reviews
Save withWalmart plus
Shipping, arrives tomorrow

Flash Deal POLIGO 22PCS Stainless Steel Grill Tools - Ideal Barbecue Gift for Men | Outdoor Cooking

Flash Deal
POLIGO 22PCS Stainless Steel Grill Tools - Ideal Barbecue Gift for Men | Outdoor Cooking
black, variant on POLIGO 22PCS Stainless Steel Grill Tools - Ideal Barbecue Gift for Men | Outdoor Cooking
brown, variant on POLIGO 22PCS Stainless Steel Grill Tools - Ideal Barbecue Gift for Men | Outdoor Cooking
silver, variant on POLIGO 22PCS Stainless Steel Grill Tools - Ideal Barbecue Gift for Men | Outdoor Cooking
Now$2594$45.99You save$20.05Options from $24.98
POLIGO 22PCS Stainless Steel Grill Tools - Ideal Barbecue Gift for Men | Outdoor Cooking
4.8 out of 5 Stars. 76 reviews
Save withWalmart plus
Shipping, arrives tomorrow

Backyard Discovery Timber Rock 10' Covered Outdoor Kitchen Cook Station, Argentine Grill

Backyard Discovery Timber Rock 10' Covered Outdoor Kitchen Cook Station, Argentine Grill
Now$2,84905$3,999.00You save$1,149.95
Backyard Discovery Timber Rock 10' Covered Outdoor Kitchen Cook Station, Argentine Grill
5 out of 5 Stars. 18 reviews
Free shipping, arrives in 3+ days

Clearance Ababeny Portable Grill Basket, BBQ Grilling Basket for Outdoor Grill with Removable Handle, Stainless Steel Camping Cooking Grill Accessories for Meat Chicken Fish Vegetable

Clearance
Ababeny Portable Grill Basket, BBQ Grilling Basket for Outdoor Grill with Removable Handle, Stainless Steel Camping Cooking Grill Accessories for Meat Chicken Fish Vegetable
Now$1699$29.99You save$13.00
Ababeny Portable Grill Basket, BBQ Grilling Basket for Outdoor Grill with Removable Handle, Stainless Steel Camping Cooking Grill Accessories for Meat Chicken Fish Vegetable
4.5 out of 5 Stars. 22 reviews
Save withWalmart plus
Shipping, arrives Thu, Jul 30

Home-Complete 7-Piece BBQ Grill Tool Kit - Stainless Steel BBQ Accessories Kitchen Set

Home-Complete 7-Piece BBQ Grill Tool Kit - Stainless Steel BBQ Accessories Kitchen Set
Now$1490$31.99You save$17.09
Home-Complete 7-Piece BBQ Grill Tool Kit - Stainless Steel BBQ Accessories Kitchen Set
4.5 out of 5 Stars. 92 reviews
Save withWalmart plus
Shipping, arrives Wed, Jul 29

Walchoice 18PCS Griddle Accessories Kit, Heavy Duty BBQ Accessories for Out door Grill, Grill Spatula Set with Enlarged Spatulas, Burger Press, Squeeze Bottles, Egg Rings

Walchoice 18PCS Griddle Accessories Kit, Heavy Duty BBQ Accessories for Out door Grill, Grill Spatula Set with Enlarged Spatulas, Burger Press, Squeeze Bottles, Egg Rings
Available in additional 2 options
Now$2699$50.99You save$24.00Options from $26.99 – $32.99
Walchoice 18PCS Griddle Accessories Kit, Heavy Duty BBQ Accessories for Out door Grill, Grill Spatula Set with Enlarged Spatulas, Burger Press, Squeeze Bottles, Egg Rings
4.8 out of 5 Stars. 12 reviews
Save withWalmart plus
Shipping, arrives tomorrow

Farberware Professional Stainless Steel BBQ Grill Tool Set (3 Pieces)

Farberware Professional Stainless Steel BBQ Grill Tool Set (3 Pieces)
Available in additional 2 options
$1767Options from $16.97
Farberware Professional Stainless Steel BBQ Grill Tool Set (3 Pieces)
4.7 out of 5 Stars. 151 reviews
Save withWalmart plus
Shipping, arrives tomorrow

500+ bought since yesterday Blackstone Griddle Seasoning and Cast Iron Conditioner - 6.5 oz

500+ bought since yesterday
Blackstone Griddle Seasoning and Cast Iron Conditioner - 6.5 oz
$997$1.53/oz
Blackstone Griddle Seasoning and Cast Iron Conditioner - 6.5 oz
4.7 out of 5 Stars. 5929 reviews
Save withWalmart plus
Delivery as soon as 25 minsShipping, arrives tomorrowPickup as soon as tomorrow

Rollback Blackstone Deluxe Stainless Steel Spatula Griddle Set, 6-Piece

Rollback
Blackstone Deluxe Stainless Steel Spatula Griddle Set, 6-Piece
Available in additional 2 sizes
Now$2444$29.97You save$5.53
Blackstone Deluxe Stainless Steel Spatula Griddle Set, 6-Piece
4.7 out of 5 Stars. 1115 reviews
Save withWalmart plus
Delivery as soon as 25 minsShipping, arrives tomorrowPickup as soon as tomorrow

POLIGO 22PCS Deluxe Stainless Steel Grilling Tools Set - Outdoor BBQ Gift for Men

POLIGO 22PCS Deluxe Stainless Steel Grilling Tools Set - Outdoor BBQ Gift for Men
Sponsored
Now$2498$45.99You save$21.01Options from $24.98 – $26.98
POLIGO 22PCS Deluxe Stainless Steel Grilling Tools Set - Outdoor BBQ Gift for Men
4.8 out of 5 Stars. 76 reviews
Save withWalmart plus
Shipping, arrives tomorrow

Walchoice 25 PCS Griddle Accessories Kit, Heavy Duty BBQ Accessories for Out door Grill, Grill Spatula Set with Enlarged Spatulas, Burger Press, Squeeze Bottles, Egg Rings

Walchoice 25 PCS Griddle Accessories Kit, Heavy Duty BBQ Accessories for Out door Grill, Grill Spatula Set with Enlarged Spatulas, Burger Press, Squeeze Bottles, Egg Rings
Sponsored
Now$3134$62.99You save$31.65Options from $26.99
Walchoice 25 PCS Griddle Accessories Kit, Heavy Duty BBQ Accessories for Out door Grill, Grill Spatula Set with Enlarged Spatulas, Burger Press, Squeeze Bottles, Egg Rings
4.8 out of 5 Stars. 12 reviews
Save withWalmart plus
Shipping, arrives tomorrow

21 Pieces Complete Grill Accessories Kit, Very Best Grill Gift on Birthday Wedding - Professional BBQ Accessories Set for Outdoor Camping Grilling

21 Pieces Complete Grill Accessories Kit, Very Best Grill Gift on Birthday Wedding - Professional BBQ Accessories Set for Outdoor Camping Grilling
Now$2249$39.99You save$17.50
21 Pieces Complete Grill Accessories Kit, Very Best Grill Gift on Birthday Wedding - Professional BBQ Accessories Set for Outdoor Camping Grilling
4.6 out of 5 Stars. 86 reviews
Save withWalmart plus
Shipping, arrives tomorrow

Flash Deal Consiwa 39pcs BBQ Grill Accessories Sets, Stainless Steel Barbecue Tools Kit, Suitable for Blackstone Griddle, Outdoor Camp Cooking Utensils, Father's Day Gift for Men & Chef Dad

Flash Deal
Consiwa 39pcs BBQ Grill Accessories Sets, Stainless Steel Barbecue Tools Kit, Suitable for Blackstone Griddle, Outdoor Camp Cooking Utensils, Father's Day Gift for Men & Chef Dad
Now$2699$69.99You save$43.00
Consiwa 39pcs BBQ Grill Accessories Sets, Stainless Steel Barbecue Tools Kit, Suitable for Blackstone Griddle, Outdoor Camp Cooking Utensils, Father's Day Gift for Men & Chef Dad
4.7 out of 5 Stars. 37 reviews
Save withWalmart plus
Shipping, arrives tomorrow

Rollback Expert Grill Grilling Accessories BBQ Grill Tools Set, 4 Pieces Stainless Steel Grill Kit

Rollback
Expert Grill Grilling Accessories BBQ Grill Tools Set, 4 Pieces Stainless Steel Grill Kit
Now$1196$14.97You save$3.01
Expert Grill Grilling Accessories BBQ Grill Tools Set, 4 Pieces Stainless Steel Grill Kit
4.8 out of 5 Stars. 280 reviews
Save withWalmart plus
Delivery as soon as 25 minsShipping, arrives tomorrowPickup as soon as tomorrow

Grilling Accessories BBQ Grill Tools Set, 9 Pieces Stainless Steel Grill Kit with Case, Barbecue Utensil Tool

Grilling Accessories BBQ Grill Tools Set, 9 Pieces Stainless Steel Grill Kit with Case, Barbecue Utensil Tool
Now$1798$29.99You save$12.01
Grilling Accessories BBQ Grill Tools Set, 9 Pieces Stainless Steel Grill Kit with Case, Barbecue Utensil Tool
4.7 out of 5 Stars. 160 reviews
Save withWalmart plus
Shipping, arrives tomorrow

Charbroil 3-Piece Aspire Grilling Tool Set, Stainless Steel - Fork, Spatula, & Tongs

Charbroil 3-Piece Aspire Grilling Tool Set, Stainless Steel - Fork, Spatula, & Tongs
Now$1099$20.99You save$10.00
Charbroil 3-Piece Aspire Grilling Tool Set, Stainless Steel - Fork, Spatula, & Tongs
4.2 out of 5 Stars. 6 reviews
Free shipping, arrives in 3+ days

Grill Accessories Kit,21 Pcs Heavy Duty Stainless Steel BBQ Tool Set with Aluminum Case and Apron for Outdoor Grill,Gifts

Grill Accessories Kit,21 Pcs Heavy Duty Stainless Steel BBQ Tool Set with Aluminum Case and Apron for Outdoor Grill,Gifts
Now$2375$26.99You save$3.24
Grill Accessories Kit,21 Pcs Heavy Duty Stainless Steel BBQ Tool Set with Aluminum Case and Apron for Outdoor Grill,Gifts
4.6 out of 5 Stars. 38 reviews
Save withWalmart plus
Shipping, arrives tomorrow

Best seller Expert Grill Stainless Steel and Nylon 3-Head Grill Brush, Black & Gray

Best seller
Expert Grill Stainless Steel and Nylon 3-Head Grill Brush, Black & Gray
$997
Expert Grill Stainless Steel and Nylon 3-Head Grill Brush, Black & Gray
4.3 out of 5 Stars. 142 reviews
Save withWalmart plus
Delivery as soon as 25 minsShipping, arrives tomorrowPickup as soon as tomorrow

Kojem 5" Steel Spring Handle with Mounting Bracket for BBQ Grill Wood Furnace Stove Smoker Steam Oven

Kojem 5" Steel Spring Handle with Mounting Bracket for BBQ Grill Wood Furnace Stove Smoker Steam Oven
Available in additional 3 options
$1479Options from $11.99
Kojem 5" Steel Spring Handle with Mounting Bracket for BBQ Grill Wood Furnace Stove Smoker Steam Oven
5 out of 5 Stars. 2 reviews
Free shipping, arrives in 3+ days

ROCKRAY 36PCS Griddle Accessories Kit for Blackstone,Grill Spatula Set with Apron for Flat Top Outdoor BBQ Cooking,Father's Day Gift

ROCKRAY 36PCS Griddle Accessories Kit for Blackstone,Grill Spatula Set with  Apron for Flat Top Outdoor BBQ Cooking,Father's Day Gift
$3498
ROCKRAY 36PCS Griddle Accessories Kit for Blackstone,Grill Spatula Set with Apron for Flat Top Outdoor BBQ Cooking,Father's Day Gift
4.5 out of 5 Stars. 4 reviews
Save withWalmart plus
Shipping, arrives Wed, Jul 29

Grilljoy 24PCS Grill Accessories Set with Spatula - Stainless Steel BBQ Tools for Outdoor Cooking

Grilljoy 24PCS Grill Accessories Set with Spatula - Stainless Steel BBQ Tools for Outdoor Cooking
black, variant on Grilljoy 24PCS Grill Accessories Set with Spatula - Stainless Steel BBQ Tools for Outdoor Cooking
gray, variant on Grilljoy 24PCS Grill Accessories Set with Spatula - Stainless Steel BBQ Tools for Outdoor Cooking
silver, variant on Grilljoy 24PCS Grill Accessories Set with Spatula - Stainless Steel BBQ Tools for Outdoor Cooking
Now$2799$36.99You save$9.00Options from $22.56
Grilljoy 24PCS Grill Accessories Set with Spatula - Stainless Steel BBQ Tools for Outdoor Cooking
4.9 out of 5 Stars. 115 reviews
Save withWalmart plus
Shipping, arrives tomorrow

Weber Stainless Steel Value Tool Set 2 Pieces

Weber Stainless Steel Value Tool Set 2 Pieces
$2499+$6.49 shipping
Weber Stainless Steel Value Tool Set 2 Pieces
4.5 out of 5 Stars. 10 reviews
Shipping, arrives in 3+ days

Rollback Blackstone Professional Griddle Accessory Tool Kit, 5-Piece

Rollback
Blackstone Professional Griddle Accessory Tool Kit, 5-Piece
Now$1496$21.97You save$7.01
Blackstone Professional Griddle Accessory Tool Kit, 5-Piece
4.5 out of 5 Stars. 1530 reviews
Save withWalmart plus
Delivery as soon as 25 minsShipping, arrives tomorrowPickup as soon as tomorrow

34 Pcs Grill Accessories Grilling Gifts for Men, Heavy Duty Stainless Steel BBQ Grill Tools Set for Outdoor Grill

34 Pcs Grill Accessories Grilling Gifts for Men, Heavy Duty Stainless Steel BBQ Grill Tools Set for Outdoor Grill
Brown, variant on 34 Pcs Grill Accessories Grilling Gifts for Men, Heavy Duty Stainless Steel BBQ Grill Tools Set for Outdoor Grill
Silver, variant on 34 Pcs Grill Accessories Grilling Gifts for Men, Heavy Duty Stainless Steel BBQ Grill Tools Set for Outdoor Grill
Now$2803$65.99You save$37.96Options from $26.99
34 Pcs Grill Accessories Grilling Gifts for Men, Heavy Duty Stainless Steel BBQ Grill Tools Set for Outdoor Grill
4.6 out of 5 Stars. 457 reviews
Save withWalmart plus
Shipping, arrives Wed, Jul 29

LotFancy Griddle Accessories Kit, 14 Pcs Grill Accessories Set for Blackstone and Camp Chef

LotFancy Griddle Accessories Kit, 14 Pcs Grill Accessories Set for Blackstone and Camp Chef
Available in additional 2 options
Now$1599$32.99You save$17.00Options from $14.99
LotFancy Griddle Accessories Kit, 14 Pcs Grill Accessories Set for Blackstone and Camp Chef
4.2 out of 5 Stars. 13 reviews
Save withWalmart plus
Shipping, arrives tomorrow

KOYMISKU Grill Accessories, Stainless Steel Grip Barbecue Accessories for Outdoor Camping, 15 Flat Top Griddle Accessories Kit with Spatula, Basting Cover, Scraper,Bottle,Tongs,Egg Rings & Carry Bag

KOYMISKU Grill Accessories, Stainless Steel Grip Barbecue Accessories for Outdoor Camping, 15 Flat Top Griddle Accessories Kit with Spatula, Basting Cover, Scraper,Bottle,Tongs,Egg Rings & Carry Bag
Available in additional 2 options
$2599
KOYMISKU Grill Accessories, Stainless Steel Grip Barbecue Accessories for Outdoor Camping, 15 Flat Top Griddle Accessories Kit with Spatula, Basting Cover, Scraper,Bottle,Tongs,Egg Rings & Carry Bag
4.7 out of 5 Stars. 525 reviews
Save withWalmart plus
Shipping, arrives Thu, Jul 30

Charbroil Comfort Grip 13-Piece Griddle Tool Set - CB1250069P3

Charbroil Comfort Grip 13-Piece Griddle Tool Set - CB1250069P3
$3506
Charbroil Comfort Grip 13-Piece Griddle Tool Set - CB1250069P3
5 out of 5 Stars. 2 reviews
Free shipping, arrives in 3+ days

Oxenhors Griddle Accessories Kit, 26Pcs Grilling Accessories Set for Blackstone and Camp Chef, Flat Top Grill Accessories Set with Spatulas, Scraper, Egg Ring, Tong, Basting Cover for Outdoor BBQ

Oxenhors Griddle Accessories Kit, 26Pcs Grilling Accessories Set for Blackstone and Camp Chef, Flat Top Grill Accessories Set with Spatulas, Scraper, Egg Ring, Tong, Basting Cover for Outdoor BBQ
$1989
Oxenhors Griddle Accessories Kit, 26Pcs Grilling Accessories Set for Blackstone and Camp Chef, Flat Top Grill Accessories Set with Spatulas, Scraper, Egg Ring, Tong, Basting Cover for Outdoor BBQ
4.6 out of 5 Stars. 37 reviews
Save withWalmart plus
Shipping, arrives Wed, Jul 29

2pcs-LELEE Rib Prep Tool with Arc Clamp and Non-Slip Grip, Stainless Steel BBQ Rib Skinner for Easy Membrane Removal, Kitchen Grill Accessory

2pcs-LELEE Rib Prep Tool with Arc Clamp and Non-Slip Grip, Stainless Steel BBQ Rib Skinner for Easy Membrane Removal, Kitchen Grill Accessory
$1099
2pcs-LELEE Rib Prep Tool with Arc Clamp and Non-Slip Grip, Stainless Steel BBQ Rib Skinner for Easy Membrane Removal, Kitchen Grill Accessory
5 out of 5 Stars. 2 reviews
Save withWalmart plus
Shipping, arrives Thu, Jul 30

About Grill Tool Sets in Grill Tools & Utensils - Walmart.com

Make your summer celebrations and Fourth of July cookouts easier and more enjoyable by finding the grill tool set that suits your outdoor cooking style. With so many options available at Walmart, you can quickly discover grilling kits that streamline prep, improve safety, and keep your tools tidy whether you're at home or heading out.

  • Discover grilling solutions: Explore sets that match the size of your gathering and the foods you want to grill, making it easy to find the right fit for parties or everyday meals.
  • Efficient comparison: Choose between various materials like stainless steel or wood handled utensils, with options ranging from basic to comprehensive tool collections for advanced grilling needs.
  • Build purchase confidence: Look for features such as dishwasher-safe items or included storage cases, so you know your grill tools can be easily cleaned and stored after a busy cookout.
  • Reliable usage value: Sets with longer handles and non-slip grips offer steady control over hot grates, helping you cook safely and serve your guests with confidence.
  • Versatile occasions: From backyard barbecues to campsites and tailgates, grill tool sets equipped with extras like spatulas, tongs, skewers, and cleaning brushes give you flexibility for any summer event.

Let Walmart help you find grilling accessories that fit your plans—so you can enjoy a stress-free, memorable cookout all season long.

FAQ

How do I pick the right grill tool set?

Choosing a grill tool set depends on how you like to grill and the size of your gatherings.

  • If you’re prepping for a big barbecue, larger sets with extras like brushes, skewers, and cleaning tools may be more helpful.
  • Look for sets with a sturdy carry case, which makes storing and traveling easier.
  • Handle materials like stainless steel offer durability if you grill often, while wood can give a comfortable grip for longer cooking sessions.
  • Consider how many pieces you truly need based on the foods you’ll serve, and check if the set includes dishwasher-safe parts for simple cleanup.

What tools are must-haves for summer grilling?

For summer grilling, there are a few essentials to keep your cookout running smoothly.

  • A spatula, sturdy tongs, and a grill fork cover basic flipping and turning.
  • Basting brushes are handy for adding flavor and keeping food juicy.
  • If you grill delicate items like fish or veggies, wide spatulas and locking tongs provide extra control.
  • Don’t forget a cleaning brush or scraper for tidying up between batches.
  • Many sets include storage cases, which help keep everything organized before and after your outdoor event.

How can I store grill tools after a cookout?

Keeping grill tools organized after your cookout can make your next barbecue much easier.

  • Many sets come with aluminum cases, canvas rolls, or apron-style holders for easy storage and transport.
  • Wipe down each tool and make sure they’re dry before storing them to prevent rust.
  • Dishwasher-safe pieces can be cleaned quickly and returned to their case.
  • If your tools don’t have a dedicated case, store them in a kitchen drawer or hang them using built-in loops to keep them accessible and tidy.

Are grill tool sets good for camping and tailgates?

Grill tool sets are a practical choice for camping and tailgate cookouts, since portability is key.

  • Look for sets with compact, sturdy cases or canvas rolls—these protect utensils and make them easy to pack.
  • Multi-piece sets can handle varied foods, from burgers to veggies.
  • Sets designed for travel often have lightweight tools and space-saving storage, so you won’t have to juggle loose utensils.
  • Basting brushes, spatulas, tongs, and cleaning tools all help make your outdoor cooking easier, wherever you grill.

What’s the best way to clean grill utensils?

Keeping your grill utensils clean can help them last longer and stay safe for use.

  • Use a grill brush or scraper to remove stuck-on food after every batch.
  • Soak tools in warm, soapy water to loosen residue, then rinse and dry thoroughly.
  • Stainless steel utensils are often dishwasher-safe, making cleanup quick.
  • Wood-handled tools should be hand-washed and dried right away to prevent splitting or warping.
  • Regular cleaning makes grilling easier and helps your tools stay in great shape for every cookout.