CLEENTABLEStyle-CarryefavormartBetter Homes & GardensCNDRLEFTiezhimiIhvewuoBangBoomHBKZDWQFAUnbrandedFingercraftBEKWSBalsa CircleoverandbackSherryTrinyaaNalerDienrxWICVIKSINKOOMainstaysSKAVIJClispeedHAMPPLIESFennco StylesYoyauzOFEFETIITSTOYNbyglhhHilingotoGoXteamOngmiesMKLZHBBKVIOunonaSaro LifestyleVislandBusSunsetJOWBOOWFusipuTopchancesZiediopCrafts CentralHomefordNOBRANDFtwytpCJIAWYSZendureJingyangRastogi HandicraftstoyokarBeautynvtaSimply GoodCheers.USDayupTABLZONEVibhsaMT ProductsINOX ArtisansRENACLIPYClassy R UsLunxisenPebbuoyEeaseRaindropsManunclaimsDollcubeDalrosiaYL MainlandToorisePogalaVAULTGodingerQuaqdaeAooowerPark DesignsiLOTWoodpeckersENEOCAREPretxorveHONITANOSOPOTUTUHowoIkohbadgOcibmnLOLIPPYYBESTYASHUxcellFOMIYESHONMEETHzHzhen69ANHXNZbinXiang30acdancYUHUABD25FDurnioWHAMVOXXueJZ65DremarieDQQ153XanyeMilistenCookhouseAxiomaHOOWIFFYMasteelfMLINSKAKOWELYLABSERRONPYJDMAELAYARDWORGEOUSYangJING616ZhangSEETHZZLEWEUVEBFONDOTINFrcolorOuliiHomemaxsNamziC&F HomeGOOHOCHYZhlili315FENGGUIQUPAMINGONOSTRANDCHICTEHAUXTIDYAMOWASHWEPEFELTECHELECTRSEWCHICSBPPEGGETAJGHSDUPGRATORZhugeifundomMOKKHNBNICERIOnicexmasDEEPCRAFFERDOUYKONTONTYLITINKIMIMERRYHAPYDRAFIDEEPOFFIGAMALBHFEtereautyGenericHemotonLIUDXiauyyMobutofuSplit PAURARMLETCTIRCHIUHEANUJJNVZIIDEANATEGRATEleorxADDHATANXPTIMEFUEENIRVAINTERWARMMINKISSYPENIKOKOYOSADIERYwmsflFUTUREORYY///WRITWAAHOMOYOYONvzi-aPapolorWINDLANDYIGSECUCOSMOBETTYNamzi-bSDFGTstoreTDZTMNDNBTINEASURUltniceZeiwohndcNUOLUXWeiyan KJYongCoServette HomeTITINICEUPOUARTWEAVILUXCIMAXICDHJPSTUYWHytroveKRYTJACZNvzi -bPandahallPTOOTPValley Forge
Sort by|

Napkin Rings in Table Linens

Uses item details. Price when purchased online

Pearl Napkin Rings Set of 24, Elegant Beaded Serviette Holders for Wedding, Party, and Holiday Dinner Table Decor, Elastic Design $9.44 Was $11.29

Pearl Napkin Rings Set of 24, Elegant Beaded Serviette Holders for Wedding, Party, and Holiday Dinner Table Decor, Elastic Design
Sponsored
current price Now $9.44, Was $11.29

Pearl Napkin Rings Set of 24, Elegant Beaded Serviette Holders for Wedding, Party, and Holiday Dinner Table Decor, Elastic Design

4.9 out of 5 Stars. 14 reviews
Save with
Walmart Plus
Shipping arrives Fri, Jul 17

FINGERCRAFT Napkin Rings, Beaded Napkin Holder, Set of 4 Buckles for Table Decorations, Wedding, Dinner, Party, Easy to Clean, Durable Metal Beaded Rings $14.99

FINGERCRAFT Napkin Rings, Beaded Napkin Holder, Set of 4 Buckles for Table Decorations, Wedding, Dinner, Party, Easy to Clean, Durable Metal Beaded Rings
Sponsored
current price $14.99
Options from $9.99

FINGERCRAFT Napkin Rings, Beaded Napkin Holder, Set of 4 Buckles for Table Decorations, Wedding, Dinner, Party, Easy to Clean, Durable Metal Beaded Rings

5 out of 5 Stars. 1 reviews
Save with
Walmart Plus
Shipping arrives Sat, Jul 18

20 Pcs Gold Napkin Rings Set, Solid Zinc Alloy Leaf Shaped Design, Reusable Elegant Table Decor, for Party Dinner, Holidays, Wedding, Easter $12.99

20 Pcs Gold Napkin Rings Set, Solid Zinc Alloy Leaf Shaped Design, Reusable Elegant Table Decor, for Party Dinner, Holidays, Wedding, Easter
Sponsored
current price $12.99

20 Pcs Gold Napkin Rings Set, Solid Zinc Alloy Leaf Shaped Design, Reusable Elegant Table Decor, for Party Dinner, Holidays, Wedding, Easter

Save with
Walmart Plus
Shipping arrives Fri, Jul 17

JOWBOOW Boho Macrame Dining Table Runner, 12x78 in, Beige $16.99

JOWBOOW Boho Macrame Dining Table Runner, 12x78 in, Beige
Sponsored
current price $16.99

JOWBOOW Boho Macrame Dining Table Runner, 12x78 in, Beige

Save with
Walmart Plus
Shipping arrives Fri, Jul 17

Efavormart 4 PCS Wholesale Red Acrylic Napkin Rings for Place Settings Wedding Receptions Dinner or Holiday Parties Tableware $4.82

Efavormart 4 PCS Wholesale Red Acrylic Napkin Rings for Place Settings Wedding Receptions Dinner or Holiday Parties Tableware
Black, variant on Efavormart 4 PCS Wholesale Red Acrylic Napkin Rings for Place Settings Wedding Receptions Dinner or Holiday Parties Tableware
Blush, variant on Efavormart 4 PCS Wholesale Red Acrylic Napkin Rings for Place Settings Wedding Receptions Dinner or Holiday Parties Tableware
Red, variant on Efavormart 4 PCS Wholesale Red Acrylic Napkin Rings for Place Settings Wedding Receptions Dinner or Holiday Parties Tableware
Silver, variant on Efavormart 4 PCS Wholesale Red Acrylic Napkin Rings for Place Settings Wedding Receptions Dinner or Holiday Parties Tableware
current price $4.82
+$4.99 shipping

Efavormart 4 PCS Wholesale Red Acrylic Napkin Rings for Place Settings Wedding Receptions Dinner or Holiday Parties Tableware

4.7 out of 5 Stars. 61 reviews
Shipping arrives in 3+ days

Set of 12 Handcrafted Napkin Rings - Aluminum Round Napkin Holders for Dining Table Décor (Shiny Gold) $15.99

Set of 12 Handcrafted Napkin Rings - Aluminum Round Napkin Holders for Dining Table Décor (Shiny Gold)
Champagne Tint, variant on Set of 12 Handcrafted Napkin Rings - Aluminum Round Napkin Holders for Dining Table Décor (Shiny Gold)
Copper Bronze, variant on Set of 12 Handcrafted Napkin Rings - Aluminum Round Napkin Holders for Dining Table Décor (Shiny Gold)
Fancy Black, variant on Set of 12 Handcrafted Napkin Rings - Aluminum Round Napkin Holders for Dining Table Décor (Shiny Gold)
High Gloss Silver, variant on Set of 12 Handcrafted Napkin Rings - Aluminum Round Napkin Holders for Dining Table Décor (Shiny Gold)
current price $15.99
Options from $15.99 – $19.99

Set of 12 Handcrafted Napkin Rings - Aluminum Round Napkin Holders for Dining Table Décor (Shiny Gold)

4.7 out of 5 Stars. 21 reviews
Save with
Walmart Plus
Shipping arrives Sat, Jul 18

Overall pick Better Homes & Garden Napkin Rings, Brown, 4 Pieces $10.32 $2.58/ea

Overall pick
Better Homes & Garden Napkin Rings, Brown, 4 Pieces
Available in additional 2 options
current price $10.32
$2.58/ea
Options from $10.32 – $20.64

Better Homes & Garden Napkin Rings, Brown, 4 Pieces

4.9 out of 5 Stars. 111 reviews
Save with
Walmart Plus
Delivery as soon as 25 mins
Shipping arrives tomorrow
Pickup as soon as tomorrow

Pearl Napkin Rings Set of 24, Elegant Beaded Serviette Holders for Wedding, Party, and Holiday Dinner Table Decor, Elastic Design $9.44 Was $11.29

Pearl Napkin Rings Set of 24, Elegant Beaded Serviette Holders for Wedding, Party, and Holiday Dinner Table Decor, Elastic Design
current price Now $9.44, Was $11.29

Pearl Napkin Rings Set of 24, Elegant Beaded Serviette Holders for Wedding, Party, and Holiday Dinner Table Decor, Elastic Design

4.9 out of 5 Stars. 14 reviews
Save with
Walmart Plus
Shipping arrives Fri, Jul 17

Pink Flower Napkin Rings Set of 4 Floral Napkin Rings Rose Napkin Holder Handcraft Flower Napkin Rings Wedding Table Decoration for Valentine's Day Wedding Banquet Birthday Party (Pink Rose) $4.76

Pink Flower Napkin Rings Set of 4 Floral Napkin Rings Rose Napkin Holder Handcraft Flower Napkin Rings Wedding Table Decoration for Valentine's Day Wedding Banquet Birthday Party (Pink Rose)
Navy, variant on Pink Flower Napkin Rings Set of 4 Floral Napkin Rings Rose Napkin Holder Handcraft Flower Napkin Rings Wedding Table Decoration for Valentine's Day Wedding Banquet Birthday Party (Pink Rose)
Pink, variant on Pink Flower Napkin Rings Set of 4 Floral Napkin Rings Rose Napkin Holder Handcraft Flower Napkin Rings Wedding Table Decoration for Valentine's Day Wedding Banquet Birthday Party (Pink Rose)
Red, variant on Pink Flower Napkin Rings Set of 4 Floral Napkin Rings Rose Napkin Holder Handcraft Flower Napkin Rings Wedding Table Decoration for Valentine's Day Wedding Banquet Birthday Party (Pink Rose)
White, variant on Pink Flower Napkin Rings Set of 4 Floral Napkin Rings Rose Napkin Holder Handcraft Flower Napkin Rings Wedding Table Decoration for Valentine's Day Wedding Banquet Birthday Party (Pink Rose)
current price $4.76
+$3.99 shipping
Options from $4.76 – $6.15

Pink Flower Napkin Rings Set of 4 Floral Napkin Rings Rose Napkin Holder Handcraft Flower Napkin Rings Wedding Table Decoration for Valentine's Day Wedding Banquet Birthday Party (Pink Rose)

5 out of 5 Stars. 1 reviews
Shipping arrives in 3+ days

CNDRLEF 10 Pack Matte Gold Napkin Rings - Stainless Steel Semicircle Ring Holder for Wedding, Christmas, Party Dinner Table Setting $12.99 Was $20.99

CNDRLEF 10 Pack Matte Gold Napkin Rings - Stainless Steel Semicircle Ring Holder for Wedding, Christmas, Party Dinner Table Setting
current price Now $12.99, Was $20.99

CNDRLEF 10 Pack Matte Gold Napkin Rings - Stainless Steel Semicircle Ring Holder for Wedding, Christmas, Party Dinner Table Setting

4.4 out of 5 Stars. 12 reviews
Save with
Walmart Plus
Shipping arrives tomorrow

60Pcs Silver Disposable Pearl Napkin Rings, Imitation White Beaded Napkin Rings Holder, White&Silver Beaded Serviette Buckles for Wedding Home Decor Daily Use and Party Supplies $24.99

60Pcs Silver Disposable Pearl Napkin Rings, Imitation White Beaded Napkin Rings Holder, White&Silver Beaded Serviette Buckles for Wedding Home Decor Daily Use and Party Supplies
Sponsored
current price $24.99

60Pcs Silver Disposable Pearl Napkin Rings, Imitation White Beaded Napkin Rings Holder, White&Silver Beaded Serviette Buckles for Wedding Home Decor Daily Use and Party Supplies

Save with
Walmart Plus
Shipping arrives Sat, Jul 18

CNDRLEF 10 Pack Matte Gold Napkin Rings - Stainless Steel Semicircle Ring Holder for Wedding, Christmas, Party Dinner Table Setting $12.99 Was $20.99

CNDRLEF 10 Pack Matte Gold Napkin Rings - Stainless Steel Semicircle Ring Holder for Wedding, Christmas, Party Dinner Table Setting
Sponsored
current price Now $12.99, Was $20.99

CNDRLEF 10 Pack Matte Gold Napkin Rings - Stainless Steel Semicircle Ring Holder for Wedding, Christmas, Party Dinner Table Setting

4.4 out of 5 Stars. 12 reviews
Save with
Walmart Plus
Shipping arrives tomorrow

FINGERCRAFT Napkin Rings, Beaded Napkin Holder, Set of 4 Buckles for Table Decorations, Wedding, Dinner, Party, Easy to Clean, Durable Metal Beaded Rings $14.99

FINGERCRAFT Napkin Rings, Beaded Napkin Holder, Set of 4 Buckles for Table Decorations, Wedding, Dinner, Party, Easy to Clean, Durable Metal Beaded Rings
Brilliant, variant on FINGERCRAFT Napkin Rings, Beaded Napkin Holder, Set of 4 Buckles for Table Decorations, Wedding, Dinner, Party, Easy to Clean, Durable Metal Beaded Rings
Brown/Ivory, variant on FINGERCRAFT Napkin Rings, Beaded Napkin Holder, Set of 4 Buckles for Table Decorations, Wedding, Dinner, Party, Easy to Clean, Durable Metal Beaded Rings
Checkered, variant on FINGERCRAFT Napkin Rings, Beaded Napkin Holder, Set of 4 Buckles for Table Decorations, Wedding, Dinner, Party, Easy to Clean, Durable Metal Beaded Rings
Flower Lace, variant on FINGERCRAFT Napkin Rings, Beaded Napkin Holder, Set of 4 Buckles for Table Decorations, Wedding, Dinner, Party, Easy to Clean, Durable Metal Beaded Rings
current price $14.99
Options from $9.99

FINGERCRAFT Napkin Rings, Beaded Napkin Holder, Set of 4 Buckles for Table Decorations, Wedding, Dinner, Party, Easy to Clean, Durable Metal Beaded Rings

5 out of 5 Stars. 1 reviews
Save with
Walmart Plus
Shipping arrives Sat, Jul 18

Clearance HBK Set of 20 Gold Floral Napkin Rings, Elegant Metal Holders for Weddings, Holiday Dinners, and Banquets $14.99 Was $19.99

Clearance
HBK Set of 20 Gold Floral Napkin Rings, Elegant Metal Holders for Weddings, Holiday Dinners, and Banquets
Available in additional 5 options
current price Now $14.99, Was $19.99

HBK Set of 20 Gold Floral Napkin Rings, Elegant Metal Holders for Weddings, Holiday Dinners, and Banquets

5 out of 5 Stars. 6 reviews
Save with
Walmart Plus
Shipping arrives Fri, Jul 17
Only 1 left

Efavormart 4 Pack | Clear Acrylic Square Mini Bud Vase Napkin Rings, 2-In-1 Flower Napkin Holders $8.86 Was $11.99

Efavormart 4 Pack | Clear Acrylic Square Mini Bud Vase Napkin Rings, 2-In-1 Flower Napkin Holders
Clear, variant on Efavormart 4 Pack | Clear Acrylic Square Mini Bud Vase Napkin Rings, 2-In-1 Flower Napkin Holders
Gold, variant on Efavormart 4 Pack | Clear Acrylic Square Mini Bud Vase Napkin Rings, 2-In-1 Flower Napkin Holders
Silver, variant on Efavormart 4 Pack | Clear Acrylic Square Mini Bud Vase Napkin Rings, 2-In-1 Flower Napkin Holders
current price Now $8.86, Was $11.99
+$4.99 shipping
Options from $7.87

Efavormart 4 Pack | Clear Acrylic Square Mini Bud Vase Napkin Rings, 2-In-1 Flower Napkin Holders

4.4 out of 5 Stars. 36 reviews
Shipping arrives in 3+ days
Only 2 left

6 Pieces Wooden Bead Napkin Rings, Farmhouse Stretchable Napkin Rings with Tassel Boho Napkin Rings for Dining Table,Wedding Decoration $9.59

6 Pieces Wooden Bead Napkin Rings, Farmhouse Stretchable Napkin Rings with Tassel Boho Napkin Rings for Dining Table,Wedding Decoration
Black, variant on 6 Pieces Wooden Bead Napkin Rings, Farmhouse Stretchable Napkin Rings with Tassel Boho Napkin Rings for Dining Table,Wedding Decoration
Blue, variant on 6 Pieces Wooden Bead Napkin Rings, Farmhouse Stretchable Napkin Rings with Tassel Boho Napkin Rings for Dining Table,Wedding Decoration
Burgundy, variant on 6 Pieces Wooden Bead Napkin Rings, Farmhouse Stretchable Napkin Rings with Tassel Boho Napkin Rings for Dining Table,Wedding Decoration
Gold, variant on 6 Pieces Wooden Bead Napkin Rings, Farmhouse Stretchable Napkin Rings with Tassel Boho Napkin Rings for Dining Table,Wedding Decoration
current price $9.59
Options from $9.59 – $10.75

6 Pieces Wooden Bead Napkin Rings, Farmhouse Stretchable Napkin Rings with Tassel Boho Napkin Rings for Dining Table,Wedding Decoration

5 out of 5 Stars. 1 reviews
Free shipping, arrives in 3+ days

Clearance Gold Napkin Rings-12 PCS Metal Spiral Napkin Rings(Spiral) Napkin Holders Buckles for Family Dinner, Wedding, Party,Table Decorations $11.99 Was $39.99

Clearance
Gold Napkin Rings-12 PCS Metal Spiral Napkin Rings(Spiral) Napkin Holders Buckles for Family Dinner, Wedding, Party,Table Decorations
current price Now $11.99, Was $39.99

Gold Napkin Rings-12 PCS Metal Spiral Napkin Rings(Spiral) Napkin Holders Buckles for Family Dinner, Wedding, Party,Table Decorations

Save with
Walmart Plus
Shipping arrives Fri, Jul 17

20 Pcs Gold Napkin Rings Set, Solid Zinc Alloy Leaf Shaped Design, Reusable Elegant Table Decor, for Party Dinner, Holidays, Wedding, Easter $12.99

20 Pcs Gold Napkin Rings Set, Solid Zinc Alloy Leaf Shaped Design, Reusable Elegant Table Decor, for Party Dinner, Holidays, Wedding, Easter
current price $12.99

20 Pcs Gold Napkin Rings Set, Solid Zinc Alloy Leaf Shaped Design, Reusable Elegant Table Decor, for Party Dinner, Holidays, Wedding, Easter

Save with
Walmart Plus
Shipping arrives Fri, Jul 17

12-Pack Napkin Rings, Silver Leaf Napkin Rings, Leaf-shaped Elegant Napkin Rings, for Table Setting Parties, Weddings, Christmas, Easter, Thanksgiving, Gifts for Housewarming $11.98

12-Pack Napkin Rings, Silver Leaf Napkin Rings, Leaf-shaped Elegant Napkin Rings, for Table Setting Parties, Weddings, Christmas, Easter, Thanksgiving, Gifts for Housewarming
current price $11.98

12-Pack Napkin Rings, Silver Leaf Napkin Rings, Leaf-shaped Elegant Napkin Rings, for Table Setting Parties, Weddings, Christmas, Easter, Thanksgiving, Gifts for Housewarming

5 out of 5 Stars. 1 reviews
Save with
Walmart Plus
Shipping arrives Sat, Jul 18

Set of 12 Handcrafted Napkin Rings - Epoxy Resin Round Napkin Holders for Dining Table Décor (Rainbow) $14.99

Set of 12 Handcrafted Napkin Rings - Epoxy Resin Round Napkin Holders for Dining Table Décor (Rainbow)
Multi Pastel, variant on Set of 12 Handcrafted Napkin Rings - Epoxy Resin Round Napkin Holders for Dining Table Décor (Rainbow)
Multi Pastel 2, variant on Set of 12 Handcrafted Napkin Rings - Epoxy Resin Round Napkin Holders for Dining Table Décor (Rainbow)
Rainbow, variant on Set of 12 Handcrafted Napkin Rings - Epoxy Resin Round Napkin Holders for Dining Table Décor (Rainbow)
Royal Blue, variant on Set of 12 Handcrafted Napkin Rings - Epoxy Resin Round Napkin Holders for Dining Table Décor (Rainbow)
current price $14.99
Options from $14.99 – $18.99

Set of 12 Handcrafted Napkin Rings - Epoxy Resin Round Napkin Holders for Dining Table Décor (Rainbow)

4.5 out of 5 Stars. 15 reviews
Save with
Walmart Plus
Shipping arrives Fri, Jul 17

35 Pcs of Zinc Alloy Napkin Rings, Elegant Gold Leaf Design, Ideal for Weddings, Banquets, and Formal Events, Great for Table Decor and Napkin Styling $20.98

35 Pcs of Zinc Alloy Napkin Rings, Elegant Gold Leaf Design, Ideal for Weddings, Banquets, and Formal Events, Great for Table Decor and Napkin Styling
Sponsored
current price $20.98

35 Pcs of Zinc Alloy Napkin Rings, Elegant Gold Leaf Design, Ideal for Weddings, Banquets, and Formal Events, Great for Table Decor and Napkin Styling

Save with
Walmart Plus
Shipping arrives Fri, Jul 17

Best seller Laquedecraft Set 6 Woven Water Hyacinth Napkin Rings, Holders for Christmas, Thanksgiving, Dining Table, Wedding Party $8.99 Was $9.99

Best seller
Laquedecraft Set 6 Woven Water Hyacinth Napkin Rings, Holders for Christmas, Thanksgiving, Dining Table, Wedding Party
Sponsored
current price Now $8.99, Was $9.99
Options from $8.99 – $24.99

Laquedecraft Set 6 Woven Water Hyacinth Napkin Rings, Holders for Christmas, Thanksgiving, Dining Table, Wedding Party

4.8 out of 5 Stars. 4 reviews
Save with
Walmart Plus
Shipping arrives Fri, Jul 17

60Pcs Silver Disposable Pearl Napkin Rings, Imitation White Beaded Napkin Rings Holder, White&Silver Beaded Serviette Buckles for Wedding Home Decor Daily Use and Party Supplies $24.99

60Pcs Silver Disposable Pearl Napkin Rings, Imitation White Beaded Napkin Rings Holder, White&Silver Beaded Serviette Buckles for Wedding Home Decor Daily Use and Party Supplies
Gold, variant on 60Pcs Silver Disposable Pearl Napkin Rings, Imitation White Beaded Napkin Rings Holder, White&Silver Beaded Serviette Buckles for Wedding Home Decor Daily Use and Party Supplies
Silver, variant on 60Pcs Silver Disposable Pearl Napkin Rings, Imitation White Beaded Napkin Rings Holder, White&Silver Beaded Serviette Buckles for Wedding Home Decor Daily Use and Party Supplies
current price $24.99

60Pcs Silver Disposable Pearl Napkin Rings, Imitation White Beaded Napkin Rings Holder, White&Silver Beaded Serviette Buckles for Wedding Home Decor Daily Use and Party Supplies

Save with
Walmart Plus
Shipping arrives Sat, Jul 18

Thyme & Table Metal Napkin Rings Matte Black, 4-Piece Set $6.86

Thyme & Table Metal Napkin Rings Matte Black, 4-Piece Set
current price $6.86

Thyme & Table Metal Napkin Rings Matte Black, 4-Piece Set

4.7 out of 5 Stars. 16 reviews
Save with
Walmart Plus
Shipping arrives tomorrow

Clearance 12 Count Thanksgiving Napkin Rings - Vintage Bronze Turkey Design, Rustic Fall Table Decor for Holiday Dinner, Autumn Harvest Party Supplies, Copper-Colored Holders $13.09 Was $14.57

Clearance
12 Count Thanksgiving Napkin Rings - Vintage Bronze Turkey Design, Rustic Fall Table Decor for Holiday Dinner, Autumn Harvest Party Supplies, Copper-Colored Holders
2PC-Gold, variant on 12 Count Thanksgiving Napkin Rings - Vintage Bronze Turkey Design, Rustic Fall Table Decor for Holiday Dinner, Autumn Harvest Party Supplies, Copper-Colored Holders
6PC-Gold, variant on 12 Count Thanksgiving Napkin Rings - Vintage Bronze Turkey Design, Rustic Fall Table Decor for Holiday Dinner, Autumn Harvest Party Supplies, Copper-Colored Holders
12PC-Gold, variant on 12 Count Thanksgiving Napkin Rings - Vintage Bronze Turkey Design, Rustic Fall Table Decor for Holiday Dinner, Autumn Harvest Party Supplies, Copper-Colored Holders
current price Now $13.09, Was $14.57
+$3.99 shipping
Options from $6.52

12 Count Thanksgiving Napkin Rings - Vintage Bronze Turkey Design, Rustic Fall Table Decor for Holiday Dinner, Autumn Harvest Party Supplies, Copper-Colored Holders

Shipping arrives in 3+ days

Gold Pearl Decorative, 12 pcs Napkin Rings, Elegant Holders for Wedding Party Formal & Casual Dining Table Decor $12.99

Gold Pearl Decorative, 12 pcs Napkin Rings, Elegant Holders for Wedding Party Formal & Casual Dining Table Decor
current price $12.99

Gold Pearl Decorative, 12 pcs Napkin Rings, Elegant Holders for Wedding Party Formal & Casual Dining Table Decor

5 out of 5 Stars. 1 reviews
Save with
Walmart Plus
Shipping arrives Sat, Jul 18

Set of 6 Wicker Rustic Napkin Rings, Boho Woven Napkin Rings Handmade by Water Hyacinth - Perfect for Farmhouse Party, Dining Room, Table Decoration $10.48

Set of 6 Wicker Rustic Napkin Rings, Boho Woven Napkin Rings Handmade by Water Hyacinth - Perfect for Farmhouse Party, Dining Room, Table Decoration
Available in additional 3 options
current price $10.48
Options from $10.48 – $24.48

Set of 6 Wicker Rustic Napkin Rings, Boho Woven Napkin Rings Handmade by Water Hyacinth - Perfect for Farmhouse Party, Dining Room, Table Decoration

4.8 out of 5 Stars. 18 reviews
Save with
Walmart Plus
Shipping arrives Sat, Jul 18

Reduced price GoXteam Napkin Rings Set of 12, Hand-Woven Farmhouse Natural Water Hyacinth Napkin Rings, Holiday Party, Christmas, New Year Eve, Thanksgiving Dinnerware, Easter Napkin Rings $11.99 Was $15.95

Reduced price
GoXteam Napkin Rings Set of 12, Hand-Woven Farmhouse Natural Water Hyacinth Napkin Rings, Holiday Party, Christmas, New Year Eve, Thanksgiving Dinnerware, Easter Napkin Rings
Eucalyptus Leaf, variant on GoXteam Napkin Rings Set of 12, Hand-Woven Farmhouse Natural Water Hyacinth Napkin Rings, Holiday Party, Christmas, New Year Eve, Thanksgiving Dinnerware, Easter Napkin Rings
Metal, variant on GoXteam Napkin Rings Set of 12, Hand-Woven Farmhouse Natural Water Hyacinth Napkin Rings, Holiday Party, Christmas, New Year Eve, Thanksgiving Dinnerware, Easter Napkin Rings
Water Hyacinth, variant on GoXteam Napkin Rings Set of 12, Hand-Woven Farmhouse Natural Water Hyacinth Napkin Rings, Holiday Party, Christmas, New Year Eve, Thanksgiving Dinnerware, Easter Napkin Rings
current price Now $11.99, Was $15.95
Options from $11.99 – $12.99

GoXteam Napkin Rings Set of 12, Hand-Woven Farmhouse Natural Water Hyacinth Napkin Rings, Holiday Party, Christmas, New Year Eve, Thanksgiving Dinnerware, Easter Napkin Rings

Save with
Walmart Plus
Shipping arrives tomorrow

50PCS Disposable Napkin Rings,Weddings,Hollow Napkin Buckle Towel Paper,Laser Cut Foil Paper Napkin Rings Self Adhesive Set of 50 for Party Table Settings Decoration, Dinner Parties(Pink,6.87x1.93") $6.99

50PCS Disposable Napkin Rings,Weddings,Hollow Napkin Buckle Towel Paper,Laser Cut Foil Paper Napkin Rings Self Adhesive Set of 50 for Party Table Settings Decoration, Dinner Parties(Pink,6.87x1.93")
Ivory white, variant on 50PCS Disposable Napkin Rings,Weddings,Hollow Napkin Buckle Towel Paper,Laser Cut Foil Paper Napkin Rings Self Adhesive Set of 50 for Party Table Settings Decoration, Dinner Parties(Pink,6.87x1.93")
Pink, variant on 50PCS Disposable Napkin Rings,Weddings,Hollow Napkin Buckle Towel Paper,Laser Cut Foil Paper Napkin Rings Self Adhesive Set of 50 for Party Table Settings Decoration, Dinner Parties(Pink,6.87x1.93")
Royal blue, variant on 50PCS Disposable Napkin Rings,Weddings,Hollow Napkin Buckle Towel Paper,Laser Cut Foil Paper Napkin Rings Self Adhesive Set of 50 for Party Table Settings Decoration, Dinner Parties(Pink,6.87x1.93")
Silver, variant on 50PCS Disposable Napkin Rings,Weddings,Hollow Napkin Buckle Towel Paper,Laser Cut Foil Paper Napkin Rings Self Adhesive Set of 50 for Party Table Settings Decoration, Dinner Parties(Pink,6.87x1.93")
current price $6.99
Options from $6.99 – $10.99

50PCS Disposable Napkin Rings,Weddings,Hollow Napkin Buckle Towel Paper,Laser Cut Foil Paper Napkin Rings Self Adhesive Set of 50 for Party Table Settings Decoration, Dinner Parties(Pink,6.87x1.93")

Free shipping, arrives in 3+ days

Sinkoo Napkin Rings Set of 6, Wooden Napkin Rings, Wood Bead Napkins Rings for Table Decor, Christmas Napkins Rings for Decorations Dinnerware Sets, Spring Banquet, Wedding, Holiday Dinner Party $9.99

Sinkoo Napkin Rings Set of 6, Wooden Napkin Rings, Wood Bead Napkins Rings for Table Decor, Christmas Napkins Rings for Decorations Dinnerware Sets, Spring Banquet, Wedding, Holiday Dinner Party
Available in additional 2 options
current price $9.99
Options from $9.99 – $15.99

Sinkoo Napkin Rings Set of 6, Wooden Napkin Rings, Wood Bead Napkins Rings for Table Decor, Christmas Napkins Rings for Decorations Dinnerware Sets, Spring Banquet, Wedding, Holiday Dinner Party

Free shipping, arrives in 3+ days

12-Pack Napkin Rings, Silver Leaf Napkin Rings, Leaf-shaped Elegant Napkin Rings, for Table Setting Parties, Weddings, Christmas, Easter, Thanksgiving, Gifts for Housewarming $11.98

12-Pack Napkin Rings, Silver Leaf Napkin Rings, Leaf-shaped Elegant Napkin Rings, for Table Setting Parties, Weddings, Christmas, Easter, Thanksgiving, Gifts for Housewarming
Sponsored
current price $11.98

12-Pack Napkin Rings, Silver Leaf Napkin Rings, Leaf-shaped Elegant Napkin Rings, for Table Setting Parties, Weddings, Christmas, Easter, Thanksgiving, Gifts for Housewarming

5 out of 5 Stars. 1 reviews
Save with
Walmart Plus
Shipping arrives Sat, Jul 18

Gold Pearl Decorative, 12 pcs Napkin Rings, Elegant Holders for Wedding Party Formal & Casual Dining Table Decor $12.99

Gold Pearl Decorative, 12 pcs Napkin Rings, Elegant Holders for Wedding Party Formal & Casual Dining Table Decor
Sponsored
current price $12.99

Gold Pearl Decorative, 12 pcs Napkin Rings, Elegant Holders for Wedding Party Formal & Casual Dining Table Decor

5 out of 5 Stars. 1 reviews
Save with
Walmart Plus
Shipping arrives Sat, Jul 18

Sinkoo 6pcs Blue Floral Spring Napkin Ring Set, Wedding Decor, Bohemian Vintage Glamour Style Decorative Napkin Rings Party Table Setting, Elegant Tableware Accessories $12.99

Sinkoo 6pcs Blue Floral Spring Napkin Ring Set, Wedding Decor, Bohemian Vintage Glamour Style Decorative Napkin Rings Party Table Setting, Elegant Tableware Accessories
Blue, variant on Sinkoo 6pcs Blue Floral Spring Napkin Ring Set, Wedding Decor, Bohemian Vintage Glamour Style Decorative Napkin Rings Party Table Setting, Elegant Tableware Accessories
White, variant on Sinkoo 6pcs Blue Floral Spring Napkin Ring Set, Wedding Decor, Bohemian Vintage Glamour Style Decorative Napkin Rings Party Table Setting, Elegant Tableware Accessories
current price $12.99
Options from $12.99 – $19.99

Sinkoo 6pcs Blue Floral Spring Napkin Ring Set, Wedding Decor, Bohemian Vintage Glamour Style Decorative Napkin Rings Party Table Setting, Elegant Tableware Accessories

Free shipping, arrives in 3+ days

Clearance Gold Bow Napkin Rings Set of 4, Shiny Metal Bow Knot Napkin Ring Holders Bow Tie Napkin Rings for New Year Valentine's Day Xams Wedding $4.99 Was $5.99

Clearance
Gold Bow Napkin Rings Set of 4, Shiny Metal Bow Knot Napkin Ring Holders Bow Tie Napkin Rings for New Year Valentine's Day Xams Wedding
current price Now $4.99, Was $5.99
+$2.99 shipping

Gold Bow Napkin Rings Set of 4, Shiny Metal Bow Knot Napkin Ring Holders Bow Tie Napkin Rings for New Year Valentine's Day Xams Wedding

Shipping arrives in 3+ days

Gold Napkin Ring, Metal Napkin Holder, Party Dinner Napkin Holders for Christmas Thanksgiving Table Decorations, Christmas Banquet Decoration, Hollow Round Design Napkin Ring(24 Pcs) $13.99

Gold Napkin Ring, Metal Napkin Holder, Party Dinner Napkin Holders for Christmas Thanksgiving Table Decorations, Christmas Banquet Decoration, Hollow Round Design Napkin Ring(24 Pcs)
current price $13.99

Gold Napkin Ring, Metal Napkin Holder, Party Dinner Napkin Holders for Christmas Thanksgiving Table Decorations, Christmas Banquet Decoration, Hollow Round Design Napkin Ring(24 Pcs)

5 out of 5 Stars. 1 reviews
Save with
Walmart Plus
Shipping arrives Fri, Jul 17

Napkin Rings Set of 4, Farmhouse Napkin Rings, Eucalyptus Leaf Napkin Rings, Boho Wood Beads Napkin Rings,Napkin Ring Holder for Weddings Christmas Party Table Decoration $8.99

Napkin Rings Set of 4, Farmhouse Napkin Rings, Eucalyptus Leaf Napkin Rings, Boho Wood Beads Napkin Rings,Napkin Ring Holder for Weddings Christmas Party Table Decoration
current price $8.99

Napkin Rings Set of 4, Farmhouse Napkin Rings, Eucalyptus Leaf Napkin Rings, Boho Wood Beads Napkin Rings,Napkin Ring Holder for Weddings Christmas Party Table Decoration

3.7 out of 5 Stars. 6 reviews
Save with
Walmart Plus
Shipping arrives Fri, Jul 17

BalsaCircle 4 Pieces Acrylic Napkin Rings Table Top Decorations Black $10.84

BalsaCircle 4 Pieces Acrylic Napkin Rings Table Top Decorations Black
current price $10.84

BalsaCircle 4 Pieces Acrylic Napkin Rings Table Top Decorations Black

4.8 out of 5 Stars. 28 reviews
Free shipping, arrives in 3+ days

Christmas Napkin Rings Set of 12 Bow Napkin Holders Holiday Table Decor Festive Dining Accessories Green Red Polyester Napkin Clips for Christmas Dinner Party Table Setting $7.67

Christmas Napkin Rings Set of 12 Bow Napkin Holders Holiday Table Decor Festive Dining Accessories Green Red Polyester Napkin Clips for Christmas Dinner Party Table Setting
Green, variant on Christmas Napkin Rings Set of 12 Bow Napkin Holders Holiday Table Decor Festive Dining Accessories Green Red Polyester Napkin Clips for Christmas Dinner Party Table Setting
Red, variant on Christmas Napkin Rings Set of 12 Bow Napkin Holders Holiday Table Decor Festive Dining Accessories Green Red Polyester Napkin Clips for Christmas Dinner Party Table Setting
current price $7.67
+$5.99 shipping
Options from $7.67 – $11.19

Christmas Napkin Rings Set of 12 Bow Napkin Holders Holiday Table Decor Festive Dining Accessories Green Red Polyester Napkin Clips for Christmas Dinner Party Table Setting

5 out of 5 Stars. 2 reviews
Shipping arrives in 3+ days

Patriotic Napkin Rings Independence Day Napkin Ring 4th Of July Patriotic Napkin Rings Pip Berry Napkin Rings Set Of 6 4th Of July Napkin Rings Napkinbands Patriotic $2.99 Was $4.79

Patriotic Napkin Rings Independence Day Napkin Ring 4th Of July Patriotic Napkin Rings Pip Berry Napkin Rings Set Of 6 4th Of July Napkin Rings Napkinbands Patriotic
current price Now $2.99, Was $4.79
+$2.90 shipping

Patriotic Napkin Rings Independence Day Napkin Ring 4th Of July Patriotic Napkin Rings Pip Berry Napkin Rings Set Of 6 4th Of July Napkin Rings Napkinbands Patriotic

Shipping arrives in 3+ days

JUMRHFAN 12Pcs Napkin Rings, Pearl Napkin Holder Rose Napkin Buckles for Wedding Banquet Home Party, Kitchen Decor Festival Dinning Table Decor $8.09

JUMRHFAN 12Pcs Napkin Rings, Pearl Napkin Holder Rose Napkin Buckles for Wedding Banquet Home Party, Kitchen Decor Festival Dinning Table Decor
current price $8.09

JUMRHFAN 12Pcs Napkin Rings, Pearl Napkin Holder Rose Napkin Buckles for Wedding Banquet Home Party, Kitchen Decor Festival Dinning Table Decor

5 out of 5 Stars. 1 reviews
Save with
Walmart Plus
Shipping arrives tomorrow

Efavormart 4 Pack | Shiny Gold Metal Wire Paper or Cloth Linen Napkin Rings $7.87 Was $11.99

Efavormart 4 Pack | Shiny Gold Metal Wire Paper or Cloth Linen Napkin Rings
Bamboo knuckle, variant on Efavormart 4 Pack | Shiny Gold Metal Wire Paper or Cloth Linen Napkin Rings
Geo cutout, variant on Efavormart 4 Pack | Shiny Gold Metal Wire Paper or Cloth Linen Napkin Rings
Hollow square, variant on Efavormart 4 Pack | Shiny Gold Metal Wire Paper or Cloth Linen Napkin Rings
Hollow sun flower Gold, variant on Efavormart 4 Pack | Shiny Gold Metal Wire Paper or Cloth Linen Napkin Rings
current price Now $7.87, Was $11.99
+$4.99 shipping
Options from $6.89

Efavormart 4 Pack | Shiny Gold Metal Wire Paper or Cloth Linen Napkin Rings

4.9 out of 5 Stars. 12 reviews
Shipping arrives in 3+ days

Rose Napkin Ring Set of 6, Valentines Day Napkin Rings, Napkin Ring Holders for Dining Table Metal Decor, Hollow Out Floral $14.04

Rose Napkin Ring Set of 6, Valentines Day Napkin Rings, Napkin Ring Holders for Dining Table Metal Decor, Hollow Out Floral
current price $14.04

Rose Napkin Ring Set of 6, Valentines Day Napkin Rings, Napkin Ring Holders for Dining Table Metal Decor, Hollow Out Floral

Free shipping, arrives in 3+ days

6 Pcs Round Woven Napkin Ring, Farmhouse Napkin Rings,Water Hyacinth Napkins Rings, Rustic Napkin Rings, Napkin Holder Buckles, Spring Napkin Rings for Christmas,Birthday, Thanksgiving $8.99 Was $11.99

6 Pcs Round Woven Napkin Ring, Farmhouse Napkin Rings,Water Hyacinth Napkins Rings, Rustic Napkin Rings, Napkin Holder Buckles, Spring Napkin Rings for Christmas,Birthday, Thanksgiving
6 PCS, variant on 6 Pcs Round Woven Napkin Ring, Farmhouse Napkin Rings,Water Hyacinth Napkins Rings, Rustic Napkin Rings, Napkin Holder Buckles, Spring Napkin Rings for Christmas,Birthday, Thanksgiving
12 PCS, variant on 6 Pcs Round Woven Napkin Ring, Farmhouse Napkin Rings,Water Hyacinth Napkins Rings, Rustic Napkin Rings, Napkin Holder Buckles, Spring Napkin Rings for Christmas,Birthday, Thanksgiving
current price Now $8.99, Was $11.99
Options from $8.99 – $15.99

6 Pcs Round Woven Napkin Ring, Farmhouse Napkin Rings,Water Hyacinth Napkins Rings, Rustic Napkin Rings, Napkin Holder Buckles, Spring Napkin Rings for Christmas,Birthday, Thanksgiving

4.5 out of 5 Stars. 8 reviews
Free shipping, arrives in 3+ days

6 PCS Valentines Napkin Rings 1.5" Diameter Artificial Berries Heart Floral Napkin Holders Rings for Christmas Wedding Valentine's Day Mother's Day Holiday Banquet Home Table Centerpiece Decorations $13.99

6 PCS Valentines Napkin Rings 1.5" Diameter Artificial Berries Heart Floral Napkin Holders Rings for Christmas Wedding Valentine's Day Mother's Day Holiday Banquet Home Table Centerpiece Decorations
Available in additional 2 options
current price $13.99
Options from $13.99 – $15.99

6 PCS Valentines Napkin Rings 1.5" Diameter Artificial Berries Heart Floral Napkin Holders Rings for Christmas Wedding Valentine's Day Mother's Day Holiday Banquet Home Table Centerpiece Decorations

Free shipping, arrives in 3+ days

ACDANC Silver Leaf Napkin Rings Set - Home Decor for Cloth Napkins - Stylish Silver Napkin Holder - Kitchen Decor and Wedding Decorations Set of 6 pcs $8.04

ACDANC Silver Leaf Napkin Rings Set - Home Decor for Cloth Napkins - Stylish Silver Napkin Holder - Kitchen Decor and Wedding Decorations Set of 6 pcs
current price $8.04

ACDANC Silver Leaf Napkin Rings Set - Home Decor for Cloth Napkins - Stylish Silver Napkin Holder - Kitchen Decor and Wedding Decorations Set of 6 pcs

Free shipping, arrives in 3+ days

Dienrx Clearance Hollow Napkin Buckle Towel Paper, 50Pcs Disposable Napkin Rings Cut Foil Paper Napkin Rings Self Adhesive Set of 50 for Table Settings Decoration Dinner Parties Weddings $5.36 Was $7.37

Dienrx Clearance Hollow Napkin Buckle Towel Paper, 50Pcs Disposable Napkin Rings Cut Foil Paper Napkin Rings Self Adhesive Set of 50 for Table Settings Decoration Dinner Parties Weddings
G, variant on Dienrx Clearance Hollow Napkin Buckle Towel Paper, 50Pcs Disposable Napkin Rings Cut Foil Paper Napkin Rings Self Adhesive Set of 50 for Table Settings Decoration Dinner Parties Weddings
White, variant on Dienrx Clearance Hollow Napkin Buckle Towel Paper, 50Pcs Disposable Napkin Rings Cut Foil Paper Napkin Rings Self Adhesive Set of 50 for Table Settings Decoration Dinner Parties Weddings
current price Now $5.36, Was $7.37
+$4.90 shipping
Options from $5.09

Dienrx Clearance Hollow Napkin Buckle Towel Paper, 50Pcs Disposable Napkin Rings Cut Foil Paper Napkin Rings Self Adhesive Set of 50 for Table Settings Decoration Dinner Parties Weddings

3 out of 5 Stars. 1 reviews
Shipping arrives in 3+ days

HBBKVI Set of 4 Fabric Rose Napkin Rings Western Style Simulation Napkin Clasp Desktop Decoration Rose Napkin Ring $3.49

HBBKVI Set of 4 Fabric Rose Napkin Rings Western Style Simulation Napkin Clasp Desktop Decoration Rose Napkin Ring
Navy, variant on HBBKVI Set of 4 Fabric Rose Napkin Rings Western Style Simulation Napkin Clasp Desktop Decoration Rose Napkin Ring
Pink, variant on HBBKVI Set of 4 Fabric Rose Napkin Rings Western Style Simulation Napkin Clasp Desktop Decoration Rose Napkin Ring
Red, variant on HBBKVI Set of 4 Fabric Rose Napkin Rings Western Style Simulation Napkin Clasp Desktop Decoration Rose Napkin Ring
White, variant on HBBKVI Set of 4 Fabric Rose Napkin Rings Western Style Simulation Napkin Clasp Desktop Decoration Rose Napkin Ring
current price $3.49
+$3.00 shipping

HBBKVI Set of 4 Fabric Rose Napkin Rings Western Style Simulation Napkin Clasp Desktop Decoration Rose Napkin Ring

Shipping arrives in 3+ days

Set of 12 White Napkin , Decorative Plastic and Metal Napkin Holders for Table Setting and Party Use $7.03

Set of 12 White Napkin , Decorative Plastic and Metal Napkin Holders for Table Setting and Party Use
current price $7.03
+$1.99 shipping

Set of 12 White Napkin , Decorative Plastic and Metal Napkin Holders for Table Setting and Party Use

Shipping arrives in 3+ days

Elegant Napkin Rings Set of 4 in Red Zinc Alloy for Decorative Table Settings and Parties $12.99

Elegant Napkin Rings Set of 4 in Red Zinc Alloy for Decorative Table Settings and Parties
current price $12.99

Elegant Napkin Rings Set of 4 in Red Zinc Alloy for Decorative Table Settings and Parties

5 out of 5 Stars. 2 reviews
Free shipping, arrives in 3+ days

MKLZ Set of 6 Flower Napkin Rings, Gold Napkin Holder for Table Decor $8.99

MKLZ Set of 6 Flower Napkin Rings, Gold Napkin Holder for Table Decor
gold|6pcs, variant on MKLZ Set of 6 Flower Napkin Rings, Gold Napkin Holder for Table Decor
silver|6pcs, variant on MKLZ Set of 6 Flower Napkin Rings, Gold Napkin Holder for Table Decor
gold|12pcs, variant on MKLZ Set of 6 Flower Napkin Rings, Gold Napkin Holder for Table Decor
silver|12pcs, variant on MKLZ Set of 6 Flower Napkin Rings, Gold Napkin Holder for Table Decor
current price $8.99
Options from $8.99 – $16.99

MKLZ Set of 6 Flower Napkin Rings, Gold Napkin Holder for Table Decor

5 out of 5 Stars. 16 reviews
Save with
Walmart Plus
Shipping arrives Sat, Jul 18

About Napkin Rings in Table Linens - Walmart.com

You can compare trampoline parts by frame size, spring count, and material, so your replacement matches your setup with less guesswork. You can review springs, mats, safety nets, padding, and jumping beds in one place, which makes planning easier for your yard.

How to choose trampoline parts

When you compare trampoline parts, you should start with compatibility before you check any other detail. You should have your frame diameter, spring length, and spring count ready before you choose a replacement.

If you have a 12 ft, 14 ft, or 15 ft frame, you should measure the metal frame across the center. You should also count your springs, because 72 springs, 84 springs, and 96 springs fit different mat layouts.

For a mat or jumping bed, you should measure the frame first and then check the number of V-rings. You can get a more accurate match when your mat size and spring layout line up together.

When you shop for a trampoline safety net, you should compare enclosure style, pole count, and overall diameter. You can avoid guesswork when your net shape and attachment points match your current setup.

Key decisions for trampoline replacement parts

You can narrow trampoline replacement parts by component type, which helps you focus on the exact issue you’re fixing. You may need springs for bounce response, padding for edge coverage, or a trampoline mat replacement for worn fabric.

  • You can restore bounce by matching spring length and spring count to your frame.
  • You can refresh the jumping surface by checking mat diameter and V-ring layout.
  • You can improve enclosure coverage by matching your trampoline safety net to pole design.
  • You can update edge coverage by choosing padding sized for your frame diameter.

With the right component type, you can replace only the section that needs attention instead of changing your whole trampoline. You can keep your setup working with less trial and error when you compare these details first.

You should also consider how you use your trampoline across the week. If your yard sees frequent jumping, you may want replacement pieces designed for repeated outdoor use and steady fit.

What to look for in springs, mats, and nets

When you compare trampoline springs, you should check length, hook shape, and finish. You may want galvanized steel, because it helps resist rust during outdoor exposure.

For a trampoline mat replacement, you should look at fabric type and ring construction. You may often see UV-resistant PP, which helps the jumping surface hold up under regular sun exposure.

If you need enclosure support, you should compare net material and attachment style. You can often find PE mesh, which gives you visible enclosure coverage while staying flexible around the frame.

Padding matters when you want edge coverage over the spring area. You should measure pad width and outer diameter, so your foam and cover align with the frame edge.

You may also compare weight capacity and certification details when the manufacturer lists them on the item page. You can get clearer buying guidance when those limits match your frame size and intended household use.

How size and spring count affect fit

You should treat trampoline size and spring count as connected measurements, not separate details. You may have a 14 ft frame, but your mat still may not fit if the spring layout is wrong.

An 8 ft frame uses different proportions than a 15 ft frame, so you should verify every measurement. You may want to compare your frame diameter, spring length, and total hooks before you replace anything.

If your frame uses 72 springs, you should look for a mat designed around that exact count. If your frame uses 84 springs or 96 springs, you should match that number exactly.

You can also compare spring length from hook end to hook end after removing one spring. You can get a more accurate replacement match when you use the relaxed spring length from your current setup.

Choosing trampoline accessories for outdoor use

You may want trampoline accessories that support everyday setup and seasonal upkeep around your yard. You can pair replacement pieces with covers or anchors when you want broader outdoor support and stability.

Material choice matters when your trampoline stays outside through changing weather. You should look for galvanized steel, UV-resistant PP, and PE mesh, because each material supports a different part of the structure.

Galvanized steel helps you with rust resistance on springs and hardware. UV-resistant PP helps you maintain a dependable jump surface, while PE mesh helps you keep enclosure visibility around the frame.

Common replacement scenarios

If your bounce feels uneven, you may need new trampoline springs matched to your original length and count. You can usually notice a more balanced feel when the replacement set matches your frame layout.

If the jumping surface no longer matches your frame tightly, you may need a trampoline mat replacement. You should confirm frame size, V-ring count, and spring length before you choose a new mat.

When your enclosure no longer aligns with poles or sleeves, you may need a new trampoline safety net. You should check pole quantity, attachment method, and overall diameter for a cleaner fit.

If the outer edge needs updated coverage, you may need new padding sized to the frame and spring area. You can make comparison easier when you measure both the full frame and pad width first.

You can make smarter replacement choices when you measure carefully and compare component type, size, spring count, and material together. You can keep your trampoline feeling more consistent and ready for regular backyard use with the right match.

FAQ

What can I use if I don’t have napkin rings?

No rings? No problem. You can create a polished look with simple items you might already have.

  • Ribbon or twine: Tie a small bow around the napkin for a soft finish.
  • Paper strips: Cut cardstock or craft paper into bands and tape the ends.
  • Greenery: Tuck in a sprig of rosemary or eucalyptus (avoid damp stems on delicate fabrics).
  • Bracelets: Smooth bangles can double as rings for a fun twist.
  • Folded styles: Try a pocket or knot fold that holds shape without a ring.

Choose materials that won’t snag, stain, or leave residue, and keep edges smooth for safe, snag-free use.

What does a napkin ring do on the table?

A napkin ring keeps a folded napkin neat and adds a decorative accent to each place setting. It’s a small holder—often metal, wood, woven, beaded, or even disposable paper—that slides over a napkin to help define each guest’s spot and tie your table theme together.

  • Function: Keeps linens tidy and organized.
  • Style: Brings color, texture, or seasonal motifs to your tablescape.
  • Use cases: Great for holidays, weddings, and everyday dinners.

You’ll find a range of styles and multi-pack options on Walmart.com and in stores, suited for cloth napkins and some thicker paper napkins.

How do I pick the right napkin ring material?

Start with your table vibe and how you’ll use them.

  • Metal: Sleek and durable; usually wipes clean easily and pairs well with modern or formal settings.
  • Wood or woven: Adds warmth and texture; spot clean and dry promptly to help preserve the finish.
  • Beaded or embellished: Eye-catching for events; handle gently to avoid snags on delicate linens.
  • Porcelain/acrylic/resin: Smooth, polished look; typically wipeable.
  • Disposable paper: Convenient for large gatherings or themed parties.

Also consider napkin thickness—choose an opening that accommodates bulkier cloth napkins—and coordinate finishes with your flatware, placemats, or runner.

How are napkin rings styled for modern, everyday tables?

Modern styling leans relaxed and intentional rather than overly formal.

  • Keep it tonal: Mix soft neutrals—think linen napkins with matte metal or woven rings.
  • Add a touch of nature: Tuck a tiny sprig of greenery into the ring for texture.
  • Play with folds: A loose roll or simple knot feels current and effortless.
  • Limit colors: Two to three shades across your runner, placemats, and rings keeps it cohesive.
  • Seasonal swap: Use understated holiday motifs for timely flair without overwhelming the setting.

These ideas can help your table look pulled together for weeknights or casual hosting.

What’s the best way to clean and store napkin rings?

Care depends on material, but gentle handling usually helps.

  • Metal: Wipe with a soft cloth and mild soap; dry thoroughly to reduce water spots.
  • Wood/wicker: Spot clean with a damp cloth, then air-dry; avoid soaking.
  • Beaded/embellished: Dust carefully; if needed, lightly dab with a barely damp cloth to protect finishes.
  • Porcelain/acrylic: Wipe clean; avoid abrasive pads that may scratch.
  • Disposable paper: Recycle or discard after use, as appropriate.

Store rings together by set in small boxes or bags to prevent scratches, and keep them in a cool, dry place to help maintain their look between gatherings.