Thomas & FriendsWUDBUDZBachmann TrainsRight Track ToysLionelMTHKatoFisher-PriceMRX SolutionsWoodenfunLGBAtlasLenbarNorthlightAtlas Model RailroadPeg PeregoLEGOGeneral Jim's Toys & BricksBrioUnbrandedAtlas ShelvingBigjigs ToysEstonHomemaxsHot WheelsLittle PeoplePetbankKWANITHINKMarklinPECOBESTSKYLeeQinerswZylopaFastrackMTH Electric TrainsPitycboWoodland ScenicsyotijayAmerican FlyerGenericColcoloAasimarKato USA Inc.PIKOQccHieUsYsyqknS&P WhistlestopRaindropsAlmenclaCYFWLOLIPPYYToy2TrixWORGEOUSAFINDUSTRIAL MROleorxLionel RacingMLINSPeony and LemonSekormStarMartTnarruTT CombatUnitrackYihuala4GroundASTEMJunZheHubLEXSOMEOLittle Buster ToysLULULIONMagiDealMaxim Enterprise Inc.PAMINGONOPlanToysRoaattaSP Whistle StopVEAISWEIOUKCYlutexAce Toys LandAFXAFX RACINGAK InteractiveBESTYASHBig Dogz DesignsBrybellyCaboose IndustriesCathatrrCentral Valley Model WorksCobersConductor CarlGazechimpGUIHYLRNHobbybossHomylHONMEETLazsyLUVNIMBMaximMERIGLAREMipcaseMRLESSNkeShengNOBRANDohodhmnuPTOOTPQSTDGVPWRCP-TRACKSRENACLIPYRound 2SekromSP1STARTISTSTOBOKTANGANNIETrainLabTrumpeterYROHGKPNZeiwohndc3D to ScaleacdancAcinkeetyADDHATAFV ClubajkhsahALBHFAmosfunAosekaaAppliance Factory PartsARTILLUXAtlas Model Railrad Co., INCAzureGreenBandua WargamesBESTOYARDBKERBMC ToysBravomigoBRUDERBulk DominoesCamoplastCanGongggCarreraCarskyCengQingHonghongCode 3COMPUKASCubiculum USACustomeepledianhelloyaDIEORSYDiluopeiDolityDRAFIDEEPDU-BRODualoaiDXQZZEeaseELAYARDEndless GamesEqslftEvergreenFantasookFleischmannFomannfor BachmannfsxdhpcsgfcFUJILIFUTUREORYYfvbhtyGale Force NineGameOverGANSWANGAXIREGHQGLASSWINDSGOOHOCHYGuangLvvGUOHUIHAMPPLIESHamptonHapeHEANUJJHemotonHere2SaveHERFIERHINTRMENTHobbspringHobowHTOYHUAZHENDINGHukaiHYPERLIVINGInRoad ToysJialeisssJoyMagicJuneparkalakexiuKaplan Early Learning Company
Sort by|

Train Tracks in Cars, RC, Drones & Trains

Uses item details. Price when purchased online

Right Track Toys Wooden Train Track 52 Piece Set - 18 Feet Of Track Expansion And 5 Distinct Pieces - 100% Compatible with All Major Brands

Right Track Toys Wooden Train Track 52 Piece Set - 18 Feet Of Track Expansion And 5 Distinct Pieces - 100% Compatible with All Major Brands
Sponsored
$3095Options from $30.95 – $66.48
Right Track Toys Wooden Train Track 52 Piece Set - 18 Feet Of Track Expansion And 5 Distinct Pieces - 100% Compatible with All Major Brands
4.4 out of 5 Stars. 77 reviews
Free shipping, arrives in 3+ days

37 Pieces Train Tracks Set - Compatible with All Major Brands, Classic Railway Track with 20 Curved, 10 Straight and 2 Switches, Light Grey Toy Track Accessory for Kids

37 Pieces Train Tracks Set - Compatible with All Major Brands, Classic Railway Track with 20 Curved, 10 Straight and 2 Switches, Light Grey Toy Track Accessory for Kids
Sponsored
$2999
37 Pieces Train Tracks Set - Compatible with All Major Brands, Classic Railway Track with 20 Curved, 10 Straight and 2 Switches, Light Grey Toy Track Accessory for Kids
Save withWalmart plus
Shipping, arrives Mon, Jul 27

Best seller Construction Track Set for Kids, 206 Pcs Flexible Plastic Race Track with Electric Train and Trucks, DIY Railway Toy for Boys and Girls Ages 3–8

Best seller
Construction Track Set for Kids, 206 Pcs Flexible Plastic Race Track with Electric Train and Trucks, DIY Railway Toy for Boys and Girls Ages 3–8
Sponsored
Now$2299$29.99You save$7.00
Construction Track Set for Kids, 206 Pcs Flexible Plastic Race Track with Electric Train and Trucks, DIY Railway Toy for Boys and Girls Ages 3–8
4.2 out of 5 Stars. 58 reviews
Save withWalmart plus
Shipping, arrives Mon, Jul 27

Best seller WudBudz Wooden Train Tracks Set 60 Pcs, Wood Train Track Expansion - 100% Compatible with All Major Brands

Best seller
WudBudz Wooden Train Tracks Set 60 Pcs, Wood Train Track Expansion - 100% Compatible with All Major Brands
Sponsored
$3999
WudBudz Wooden Train Tracks Set 60 Pcs, Wood Train Track Expansion - 100% Compatible with All Major Brands
5 out of 5 Stars. 25 reviews
Save withWalmart plus
Free shipping, arrives Mon, Jul 27

Right Track Toys Wooden Train Track 52 Piece Set - 18 Feet Of Track Expansion And 5 Distinct Pieces - 100% Compatible with All Major Brands

Right Track Toys Wooden Train Track 52 Piece Set - 18 Feet Of Track Expansion And 5 Distinct Pieces - 100% Compatible with All Major Brands
Available in additional 2 options
$3095Options from $30.95 – $66.48
Right Track Toys Wooden Train Track 52 Piece Set - 18 Feet Of Track Expansion And 5 Distinct Pieces - 100% Compatible with All Major Brands
4.4 out of 5 Stars. 77 reviews
Free shipping, arrives in 3+ days

Fisher-Price Thomas & Friends Wood Expansion Track Pack

Fisher-Price Thomas & Friends Wood Expansion Track Pack
$2279
Fisher-Price Thomas & Friends Wood Expansion Track Pack
4.3 out of 5 Stars. 32 reviews
Save withWalmart plus
Shipping, arrives tomorrow
Only 1 left

Best seller Construction Track Set for Kids, 206 Pcs Flexible Plastic Race Track with Electric Train and Trucks, DIY Railway Toy for Boys and Girls Ages 3–8

Best seller
Construction Track Set for Kids, 206 Pcs Flexible Plastic Race Track with Electric Train and Trucks, DIY Railway Toy for Boys and Girls Ages 3–8
Available in additional 3 options
Now$2299$29.99You save$7.00
Construction Track Set for Kids, 206 Pcs Flexible Plastic Race Track with Electric Train and Trucks, DIY Railway Toy for Boys and Girls Ages 3–8
4.2 out of 5 Stars. 58 reviews
Save withWalmart plus
Shipping, arrives Mon, Jul 27

atlas 2414 n scale code 65 14" radius curve (8)

atlas 2414 n scale code 65 14" radius curve (8)
$2848
atlas 2414 n scale code 65 14" radius curve (8)
Free shipping, arrives in 3+ days

Replacement Part for Fisher-Price Thomas & Friends Crystal Caves & Trains Mega Set HHV21 - Replacement 1 Blue Left Turn Track TL and 1 Green Track with Switch TR

Replacement Part for Fisher-Price Thomas & Friends Crystal Caves & Trains Mega Set HHV21 - Replacement 1 Blue Left Turn Track TL and 1 Green Track with Switch TR
$2399
Replacement Part for Fisher-Price Thomas & Friends Crystal Caves & Trains Mega Set HHV21 - Replacement 1 Blue Left Turn Track TL and 1 Green Track with Switch TR
Free shipping, arrives in 3+ days

E-Z Track HO 36" Long STRAIGHTS L

E-Z Track HO 36" Long STRAIGHTS L
$2384
E-Z Track HO 36" Long STRAIGHTS L
4 out of 5 Stars. 1 reviews
Free shipping, arrives in 3+ days

VOLTWAYZ Curve Track Pieces Compatible with Hot Wheels – 4-Pack 90-Degree High-Banked Turns + 6 Connectors – Curved Corner for 1:64 Scale Racing – Blue

VOLTWAYZ Curve Track Pieces Compatible with Hot Wheels – 4-Pack 90-Degree High-Banked Turns + 6 Connectors – Curved Corner for 1:64 Scale Racing – Blue
Sponsored
$1295
VOLTWAYZ Curve Track Pieces Compatible with Hot Wheels – 4-Pack 90-Degree High-Banked Turns + 6 Connectors – Curved Corner for 1:64 Scale Racing – Blue
Free shipping, arrives in 3+ days

VOLTWAYZ Straight & Curved Track Compatible with Hot Wheels - 58-Piece XL 1:64 Scale Raceway Set (50 Feet Total) - Includes Straights, High-Banked Curves & 70 Connectors

VOLTWAYZ Straight & Curved Track Compatible with Hot Wheels - 58-Piece XL 1:64 Scale Raceway Set (50 Feet Total) - Includes Straights, High-Banked Curves & 70 Connectors
Sponsored
$4495
VOLTWAYZ Straight & Curved Track Compatible with Hot Wheels - 58-Piece XL 1:64 Scale Raceway Set (50 Feet Total) - Includes Straights, High-Banked Curves & 70 Connectors
Free shipping, arrives in 3+ days

Thomas & Friends TrackMaster Maron Bridge Expansion Pack

Thomas & Friends TrackMaster Maron Bridge Expansion Pack
$16949
Thomas & Friends TrackMaster Maron Bridge Expansion Pack
5 out of 5 Stars. 1 reviews
Free shipping, arrives in 3+ days

Overall pick Wooden Train Tracks 24 Piece Set, Track Expansion and 9 Distinct Pieces - 100% Compatible with All Major Brands Including Thomas Wooden Railway System

Overall pick
Wooden Train Tracks 24 Piece Set, Track Expansion and 9 Distinct Pieces - 100% Compatible with All Major Brands Including Thomas Wooden Railway System
Now$1709$19.99You save$2.90
Wooden Train Tracks 24 Piece Set, Track Expansion and 9 Distinct Pieces - 100% Compatible with All Major Brands Including Thomas Wooden Railway System
4.3 out of 5 Stars. 16 reviews
Save withWalmart plus
Shipping, arrives tomorrow

kato n scale unitrack double track power cord (2)

kato n scale unitrack double track power cord (2)
kato n scale unitrack double track power cord (2)
Free shipping, arrives in 3+ days

Replacement Part for Fisher-Price Thomas & Friends Crystal Caves & Trains Mega Set HHV21 - Replacement Orange - Brown Train Track Piece S1

Replacement Part for Fisher-Price Thomas & Friends Crystal Caves & Trains Mega Set HHV21 - Replacement Orange - Brown Train Track Piece S1
$1499
Replacement Part for Fisher-Price Thomas & Friends Crystal Caves & Trains Mega Set HHV21 - Replacement Orange - Brown Train Track Piece S1
3 out of 5 Stars. 1 reviews
Free shipping, arrives in 3+ days

MTH 40-1022 O RealTrax Half O-31 Curve Track 1 Piece

MTH 40-1022 O RealTrax Half O-31 Curve Track 1 Piece
$1184
MTH 40-1022 O RealTrax Half O-31 Curve Track 1 Piece
Free shipping, arrives in 3+ days

Best seller LEGO City Trains Switch Tracks 60238, 6 Pieces, Toy Train Track Extension Pack, Accessory Set

Best seller
LEGO City Trains Switch Tracks 60238, 6 Pieces, Toy Train Track Extension Pack, Accessory Set
$1280
LEGO City Trains Switch Tracks 60238, 6 Pieces, Toy Train Track Extension Pack, Accessory Set
4.7 out of 5 Stars. 79 reviews
Save withWalmart plus
Shipping, arrives tomorrow

Replacement Part for Thomas and Friends Train Set - GXH09 ~ Thomas & Friends Trains and Cranes Super Tower Playset ~ Replacement Gray Ramp Track

Replacement Part for Thomas and Friends Train Set - GXH09 ~ Thomas & Friends Trains and Cranes Super Tower Playset ~ Replacement Gray Ramp Track
$1899
Replacement Part for Thomas and Friends Train Set - GXH09 ~ Thomas & Friends Trains and Cranes Super Tower Playset ~ Replacement Gray Ramp Track
2 out of 5 Stars. 1 reviews
Free shipping, arrives in 3+ days

BESTSKY Wooden Train Track Accessory, Level Crossing Railway

BESTSKY Wooden Train Track Accessory, Level Crossing Railway
$785
BESTSKY Wooden Train Track Accessory, Level Crossing Railway
Free shipping, arrives in 3+ days

VOLTWAYZ Straight & Curved Track Compatible with Hot Wheels - 24-Piece 1:64 Scale Raceway Expansion (20 Feet Total) - Straights, High-Banked Curves & Connectors

VOLTWAYZ Straight & Curved Track Compatible with Hot Wheels - 24-Piece 1:64 Scale Raceway Expansion (20 Feet Total) - Straights, High-Banked Curves & Connectors
Sponsored
$2495
VOLTWAYZ Straight & Curved Track Compatible with Hot Wheels - 24-Piece 1:64 Scale Raceway Expansion (20 Feet Total) - Straights, High-Banked Curves & Connectors
Free shipping, arrives in 3+ days

Wooden Train Track 100 Piece Pack - 100% Compatible with All Major Brands including Thomas Wooden Railway System - By Right Track Toys

Wooden Train Track 100 Piece Pack - 100% Compatible with All Major Brands including Thomas Wooden Railway System - By Right Track Toys
Sponsored
$5295Options from $52.95 – $100.61
Wooden Train Track 100 Piece Pack - 100% Compatible with All Major Brands including Thomas Wooden Railway System - By Right Track Toys
4.8 out of 5 Stars. 5 reviews
Save withWalmart plus
Free shipping, arrives tomorrow

Best seller WudBudz Wooden Train Tracks Set 60 Pcs, Wood Train Track Expansion - 100% Compatible with All Major Brands

Best seller
WudBudz Wooden Train Tracks Set 60 Pcs, Wood Train Track Expansion - 100% Compatible with All Major Brands
$3999
WudBudz Wooden Train Tracks Set 60 Pcs, Wood Train Track Expansion - 100% Compatible with All Major Brands
5 out of 5 Stars. 25 reviews
Save withWalmart plus
Free shipping, arrives Mon, Jul 27

37 Pieces Train Tracks Set - Compatible with All Major Brands, Classic Railway Track with 20 Curved, 10 Straight and 2 Switches, Light Grey Toy Track Accessory for Kids

37 Pieces Train Tracks Set - Compatible with All Major Brands, Classic Railway Track with 20 Curved, 10 Straight and 2 Switches, Light Grey Toy Track Accessory for Kids
$2999
37 Pieces Train Tracks Set - Compatible with All Major Brands, Classic Railway Track with 20 Curved, 10 Straight and 2 Switches, Light Grey Toy Track Accessory for Kids
Save withWalmart plus
Shipping, arrives Mon, Jul 27

Replacement Part for Thomas and Friends 2 in 1 Transforming Thomas Playset - GXH08 - Gray Connector for PS1 Track

Replacement Part for Thomas and Friends 2 in 1 Transforming Thomas Playset - GXH08 - Gray Connector for PS1 Track
$1299
Replacement Part for Thomas and Friends 2 in 1 Transforming Thomas Playset - GXH08 - Gray Connector for PS1 Track
Free shipping, arrives in 3+ days

LGB G Scale Track System - Straight Track Section - 47-3/16in (120cm)

LGB G Scale Track System - Straight Track Section - 47-3/16in (120cm)
$5705
LGB G Scale Track System - Straight Track Section - 47-3/16in (120cm)
Free shipping, arrives in 3+ days

Lionel Battery O Gauge Twelve Piece Straight Plastic Track pack

Lionel Battery O Gauge Twelve Piece Straight Plastic Track pack
$1199
Lionel Battery O Gauge Twelve Piece Straight Plastic Track pack
2 out of 5 Stars. 1 reviews
Save withWalmart plus
Shipping, arrives in 3+ days

Lionel O Scale 10" Straight FasTrack Pack (4 Pieces) Model Train Track

Lionel O Scale 10" Straight FasTrack Pack (4 Pieces) Model Train Track
$2729
Lionel O Scale 10" Straight FasTrack Pack (4 Pieces) Model Train Track
4.9 out of 5 Stars. 37 reviews
Save withWalmart plus
Shipping, arrives in 3+ days

Bachmann Trains HO Scale E-Z Track Truss Bridge w/ Blinking Light Train Track Accessory

Bachmann Trains HO Scale E-Z Track Truss Bridge w/ Blinking Light Train Track Accessory
$3071
Bachmann Trains HO Scale E-Z Track Truss Bridge w/ Blinking Light Train Track Accessory
4.9 out of 5 Stars. 14 reviews
Free shipping, arrives in 3+ days

Bachmann 42208 Ho Road Crossing

Bachmann 42208 Ho Road Crossing
$2588
Bachmann 42208 Ho Road Crossing
3.7 out of 5 Stars. 6 reviews
Free shipping, arrives in 3+ days

WudBudz Wooden Train Tracks 24 Pieces Set, Track Expansion Pack with Storage Bag - Includes Male/Female Adapters - 100% Compatible with All Major Brands

WudBudz Wooden Train Tracks 24 Pieces Set, Track Expansion Pack with Storage Bag - Includes Male/Female Adapters - 100% Compatible with All Major Brands
Sponsored
Now$1799$24.99You save$7.00
WudBudz Wooden Train Tracks 24 Pieces Set, Track Expansion Pack with Storage Bag - Includes Male/Female Adapters - 100% Compatible with All Major Brands
Save withWalmart plus
Shipping, arrives Mon, Jul 27

Replacement Part for Fisher-Price Thomas and Friends Trackmaster Train Playset - CDB61 - BDP14 - Shipwreck Rails Set - Gray Curve Track EC3

Replacement Part for Fisher-Price Thomas and Friends Trackmaster Train Playset - CDB61 - BDP14 - Shipwreck Rails Set - Gray Curve Track EC3
$1599
Replacement Part for Fisher-Price Thomas and Friends Trackmaster Train Playset - CDB61 - BDP14 - Shipwreck Rails Set - Gray Curve Track EC3
Free shipping, arrives in 3+ days

Reduced price Okjoy Rail Electric Train Set 3D Magic Flexible Race Track, 91 pcs Race Car Track Block with Anti-Gravity, Educational STEM Toy, Birthday Gift for Boys Girls

Reduced price
Okjoy Rail Electric Train Set 3D Magic Flexible Race Track, 91 pcs Race Car Track Block with Anti-Gravity, Educational STEM Toy, Birthday Gift for Boys Girls
$1999
Okjoy Rail Electric Train Set 3D Magic Flexible Race Track, 91 pcs Race Car Track Block with Anti-Gravity, Educational STEM Toy, Birthday Gift for Boys Girls
Save withWalmart plus
Shipping, arrives Mon, Jul 27

Kato 20-864-1 N Scale V5 UNITRACK Inside Loop Track Set

Kato 20-864-1 N Scale V5 UNITRACK Inside Loop Track Set
$5819
Kato 20-864-1 N Scale V5 UNITRACK Inside Loop Track Set
Free shipping, arrives in 3+ days

Lionel O Scale FasTrack Outer Passing Loop Expansion Pack Model Train Track

Lionel O Scale FasTrack Outer Passing Loop Expansion Pack Model Train Track
Now$10292$159.99You save$57.07
Lionel O Scale FasTrack Outer Passing Loop Expansion Pack Model Train Track
4.5 out of 5 Stars. 13 reviews
Save withWalmart plus
Free shipping, arrives in 3+ days

Bachmann Trains HO Scale 9" Straight Nickel Silver E-Z Track - 4 Pack

Bachmann Trains HO Scale 9" Straight Nickel Silver E-Z Track - 4 Pack
$1799$17.99/cu ft
Bachmann Trains HO Scale 9" Straight Nickel Silver E-Z Track - 4 Pack
4.8 out of 5 Stars. 12 reviews
Save withWalmart plus
Shipping, arrives Tue, Jul 28

LGB G Scale Track System - R2 Curved Track Section 30-Degree 5ft 5in Diameter

LGB G Scale Track System - R2 Curved Track Section 30-Degree 5ft 5in Diameter
$3686
LGB G Scale Track System - R2 Curved Track Section 30-Degree 5ft 5in Diameter
Free shipping, arrives in 3+ days

Replacement Part for Fisher-Price Thomas and Friends Trackmaster Train Playset - CDB59 - Breakaway Bridge Set - Gray Track Piece ES6

Replacement Part for Fisher-Price Thomas and Friends Trackmaster Train Playset - CDB59 - Breakaway Bridge Set - Gray Track Piece ES6
$1599
Replacement Part for Fisher-Price Thomas and Friends Trackmaster Train Playset - CDB59 - Breakaway Bridge Set - Gray Track Piece ES6
Free shipping, arrives in 3+ days

Medium Straight Tracks, 4 Pieces

Medium Straight Tracks, 4 Pieces
$7000
Medium Straight Tracks, 4 Pieces
Free shipping, arrives in 3+ days

Replacement Part for Fisher-Price Thomas & Friends Crystal Caves & Trains Mega Set HHV21 - Replacement Blue Left Turn Track Piece with Switch - TL

Replacement Part for Fisher-Price Thomas & Friends Crystal Caves & Trains Mega Set HHV21 - Replacement Blue Left Turn Track Piece with Switch - TL
$1599
Replacement Part for Fisher-Price Thomas & Friends Crystal Caves & Trains Mega Set HHV21 - Replacement Blue Left Turn Track Piece with Switch - TL
Free shipping, arrives in 3+ days

Lionel Trains Ready to Play Straight Model Train Set Track Pieces, 12 Piece Pack

Lionel Trains Ready to Play Straight Model Train Set Track Pieces, 12 Piece Pack
$1399
Lionel Trains Ready to Play Straight Model Train Set Track Pieces, 12 Piece Pack
4.9 out of 5 Stars. 16 reviews
Save withWalmart plus
Shipping, arrives in 3+ days

Bachmann Trains - Snap-Fit E-Z TRACK 15? RADIUS CURVED TRACK (4/card) - NICKEL SILVER Rail With Gray Roadbed - HO Scale

Bachmann Trains - Snap-Fit E-Z TRACK 15? RADIUS CURVED TRACK (4/card) - NICKEL SILVER Rail With Gray Roadbed - HO Scale
Now$1794$21.50You save$3.56
Bachmann Trains - Snap-Fit E-Z TRACK 15? RADIUS CURVED TRACK (4/card) - NICKEL SILVER Rail With Gray Roadbed - HO Scale
5 out of 5 Stars. 2 reviews
Free shipping, arrives in 3+ days

Lionel Two Piece Ready to Play Left and Right Hand Manual Switch Model Train Track Pack

Lionel Two Piece Ready to Play Left and Right Hand Manual Switch Model Train Track Pack
Lionel Two Piece Ready to Play Left and Right Hand Manual Switch Model Train Track Pack
5 out of 5 Stars. 5 reviews
Free shipping, arrives in 3+ days

40PCS City Train Tracks, Classic Train Tracks Accessories, Railroad Building Toy Compatible with All Major Brand- 32 Curved, 6 Straight, 2 Integral forks train tracks

40PCS City Train Tracks, Classic Train Tracks Accessories, Railroad Building Toy Compatible with All Major Brand- 32 Curved, 6 Straight, 2 Integral forks train tracks
$3599
40PCS City Train Tracks, Classic Train Tracks Accessories, Railroad Building Toy Compatible with All Major Brand- 32 Curved, 6 Straight, 2 Integral forks train tracks
Free shipping, arrives in 3+ days

Replacement Part for Fisher-Price Thomas & Friends Crystal Caves & Trains Mega Set HHV21 - Replacement Green Train Track Piece with Switch - TR

Replacement Part for Fisher-Price Thomas & Friends Crystal Caves & Trains Mega Set HHV21 - Replacement Green Train Track Piece with Switch - TR
$1599
Replacement Part for Fisher-Price Thomas & Friends Crystal Caves & Trains Mega Set HHV21 - Replacement Green Train Track Piece with Switch - TR
Free shipping, arrives in 3+ days

Bachmann Trains - Snap-Fit E-Z TRACK 33.25 RADIUS 12 DEGREE CURVED TRACK (4/card) - NICKEL SILVER Rail With Gray Roadbed - HO Scale 44509

Bachmann Trains - Snap-Fit E-Z TRACK 33.25 RADIUS 12 DEGREE CURVED TRACK (4/card) - NICKEL SILVER Rail With Gray Roadbed - HO Scale 44509
$1982
Bachmann Trains - Snap-Fit E-Z TRACK 33.25 RADIUS 12 DEGREE CURVED TRACK (4/card) - NICKEL SILVER Rail With Gray Roadbed - HO Scale 44509
Free shipping, arrives in 3+ days

Bachmann Trains HO Scale E-Z Track 9" Straight Track - 4 Pack

Bachmann Trains HO Scale E-Z Track 9" Straight Track - 4 Pack
Now$1199$15.00You save$3.01
Bachmann Trains HO Scale E-Z Track 9" Straight Track - 4 Pack
4.8 out of 5 Stars. 37 reviews
Save withWalmart plus
Shipping, arrives Tue, Jul 28

Train Track Replacement Parts Railway Wooden Accessories Educational Toy Sets for Kids The Child 18 Pcs

Train Track Replacement Parts Railway Wooden Accessories Educational Toy Sets for Kids The Child 18 Pcs
$1357+$3.99 shipping
Train Track Replacement Parts Railway Wooden Accessories Educational Toy Sets for Kids The Child 18 Pcs
Shipping, arrives in 3+ days

maxim enterprise, inc. Wooden Train Track Over & Under Tunnel Bridge & Easy-Connect Railway, Hardwood Train Set Compatible with Thomas and Friends, BRIO, Major Brand Wooden Train Sets and Accessories

maxim enterprise, inc. Wooden Train Track Over & Under Tunnel Bridge & Easy-Connect Railway, Hardwood Train Set Compatible with Thomas and Friends, BRIO, Major Brand Wooden Train Sets and Accessories
$2499
maxim enterprise, inc. Wooden Train Track Over & Under Tunnel Bridge & Easy-Connect Railway, Hardwood Train Set Compatible with Thomas and Friends, BRIO, Major Brand Wooden Train Sets and Accessories
Save withWalmart plus
Shipping, arrives Mon, Jul 27

About Train Tracks in Cars, RC, Drones & Trains - Walmart.com

Wall decals help you refresh blank walls with less effort and less commitment than framed decor or paint. You can use wall decals to add color, shape, and personality across nurseries, bedrooms, classrooms, and playrooms.

How to choose wall decals for your space

You should start with the wall surface, because smooth painted walls usually apply differently than textured walls, glass, or wood. You can also measure your open wall area first, so your design feels balanced instead of crowded.

When you compare application types, you'll notice peel and stick wall decals are simple for quick updates and seasonal changes. You may also consider self-adhesive, water-activated, or transfer decal styles based on your surface and installation preference.

If you're decorating a rental or shared room, you'll likely want removable wall decals that lift away more easily. You should still check package directions, because your finish and texture affect how your decals apply and release.

Benefits of peel and stick wall decals

You'll get a fast room update without tools, nails, or a full paint project. You can change the mood of a nursery, bedroom, or living room with a design that fits your style.

Because you can place decals above dressers, cribs, desks, or beds, you'll have more flexibility than with many framed pieces. You can also mix wall stickers with shelves, art, or wallpaper accents for a layered look.

  • You can refresh a room with less setup and less cleanup.
  • You can choose removable wall graphics when you expect to rearrange often.
  • You can personalize shared spaces with names, quotes, animals, or geometric shapes.
  • You can update seasonal spaces like classrooms with designs that match the calendar.

If you're decorating for kids, you may want softer themes like animals, stars, florals, or nature wall decals. If you're styling a modern room, you may prefer geometric shapes, lettering, or clean line art.

Choosing application type and material

You should compare application type first, because it affects how much positioning control you have during setup. Peel and stick wall decals usually suit quick projects, while transfer decals can help you place detailed designs more precisely.

When you review materials, you'll often see vinyl wall stickers for crisp edges and easy wipe-clean care. You may also find fabric styles for a softer finish, chalkboard options for writing, and glow-in-the-dark designs for playful spaces.

Surface compatibility matters, especially if your walls have texture, paneling, glass inserts, or wood accents. You should check whether the decal is intended for textured walls, because some styles hold more evenly on smoother surfaces.

For nurseries and kids' rooms, you may look for materials labeled for children's spaces and clear use guidance. You should also review packaging details when non-toxic materials matter in your decorating decision.

Choosing room suitability and scale

You can narrow your options faster when you match room type with design size and theme. Nursery wall decals often use softer colors and gentle shapes, while wall decals for bedroom spaces can lean bold or expressive.

In a nursery, you may place clouds, animals, moons, or floral branches above a crib or changing table. In a teen bedroom, you might choose quotes, abstract patterns, or wall stickers that frame a headboard.

For living rooms, you can use larger wall graphics to anchor a sofa wall or reading corner. For classrooms and playrooms, you may want alphabet sets, numbers, maps, or bright nature scenes.

You should think about scale before you apply anything, because a small decal can disappear on a large wall. You can tape out the planned shape first, so your spacing looks intentional from across the room.

Using wall decals in everyday spaces

You can use wall decals to create a finished look in apartments, dorm-style rooms, and houses where flexibility matters. You may also use them to define zones, like a reading nook, homework area, or play corner.

If you're planning a nursery, you can choose calming colors and simple shapes that work around furniture and storage. If you're decorating siblings' rooms, you can coordinate themes without making both walls look identical.

During the school year, you might use classroom wall decals for bulletin board borders, learning corners, or seasonal themes. During room refreshes, you can swap removable wall graphics to match holidays, hobbies, or changing interests.

You can also pair decals with wallpaper, canvases, and mirrors when you want more depth on a feature wall. If your space has glass or wood accents, you should confirm surface guidance before placement.

What to look for before you apply wall decals

You should clean and dry the area first, because dust and residue can affect how evenly decals sit. You can smooth pieces gradually from one side, which helps you align edges and reduce repositioning.

If your wall has heavy texture, you may want smaller elements instead of one large design. You can also test placement with painter's tape first, so your layout feels right before final application.

When you choose wall decals with the right application type, material, and scale, your room update feels more polished. You can create a personal look that fits your walls, your routine, and your decorating plans.